StarFunc result for job id P39210

User Input

>input (176 residues)
MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCG
FVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNW
AKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19258	0.970	0.970	4.109E-22	176	0.920	0.920	P19258.pdb.gz	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
2	AFDB:Q5TZ51	0.938	0.932	1.225E-18	177	0.699	0.695	Q5TZ51.pdb.gz	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
3	AFDB:F4K2L8	0.894	0.558	1.043E-10	288	0.358	0.219	F4K2L8.pdb.gz	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
4	AFDB:Q06563	0.886	0.797	5.164E-10	197	0.301	0.269	Q06563.pdb.gz	SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYM1 PE=1 SV=1
5	AFDB:Q8VIK2	0.853	0.757	1.324E-9	200	0.290	0.255	Q8VIK2.pdb.gz	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
6	AFDB:Q567V2	0.864	0.745	2.119E-9	206	0.284	0.243	Q567V2.pdb.gz	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
7	AFDB:Q9NR77	0.878	0.797	4.716E-9	195	0.273	0.246	Q9NR77.pdb.gz	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
8	AFDB:Q9LV46	0.852	0.646	5.431E-9	235	0.341	0.255	Q9LV46.pdb.gz	Q9LV46_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=1 SV=1
9	AFDB:Q99MS3	0.886	0.807	8.695E-9	194	0.295	0.268	Q99MS3.pdb.gz	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
10	AFDB:Q9VN75	0.856	0.785	1.392E-8	193	0.199	0.181	Q9VN75.pdb.gz	Q9VN75_DROME IP08061p OS=Drosophila melanogaster OX=7227 GN=plh PE=2 SV=2
11	PDB:7vadA	0.186	0.126	7.625E-1	306	0.131	0.075	7vadA.pdb.gz
12	PDB:5gtmB	0.205	0.100	8.781E-1	522	0.102	0.034	5gtmB.pdb.gz
13	PDB:5vreA	0.170	0.164	1.060	188	0.193	0.181	5vreA.pdb.gz
14	PDB:7x9bR	0.277	0.186	1.111	302	0.125	0.073	7x9bR.pdb.gz
15	PDB:7dyrY	0.179	0.136	1.406	248	0.108	0.077	7dyrY.pdb.gz	Structure of the mannose phosphotransferase system (man-PTS) complexed with microcin E492, a pore-forming bacteriocin.
16	PDB:5nx7A	0.287	0.191	2.048	308	0.188	0.107	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.
17	PDB:7w55R	0.256	0.173	2.251	303	0.125	0.073	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
18	PDB:7o3vI	0.241	0.224	2.359	193	0.136	0.124	7o3vI.pdb.gz
19	PDB:1fdhG	0.217	0.216	2.985	147	0.131	0.156	1fdhG.pdb.gz	Structure of human foetal deoxyhaemoglobin.
20	PDB:7wq3R	0.237	0.176	2.985	289	0.148	0.090	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39210	7.17e-129	360	176	1.000	1.000	MPV17_HUMAN Protein Mpv17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1
2	P19258	1.71e-120	339	176	0.920	0.920	MPV17_MOUSE Protein Mpv17 OS=Mus musculus OX=10090 GN=Mpv17 PE=1 SV=1
3	Q5TZ51	3.74e-91	265	177	0.688	0.684	MPV17_DANRE Protein Mpv17 OS=Danio rerio OX=7955 GN=mpv17 PE=2 SV=1
4	F4K2L8	5.50e-27	105	288	0.352	0.215	F4K2L8_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At5g19750 PE=1 SV=1
5	Q9LV46	4.37e-22	90.9	235	0.369	0.277	Q9LV46_ARATH Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g24570 PE=1 SV=1
6	Q06563	7.55e-21	86.7	197	0.312	0.279	SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SYM1 PE=1 SV=1
7	Q99MS3	1.14e-17	78.6	194	0.301	0.273	MP17L_MOUSE Mpv17-like protein OS=Mus musculus OX=10090 GN=Mpv17l PE=1 SV=2
8	Q8VIK2	2.74e-17	77.4	200	0.307	0.270	M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus OX=10090 GN=Mpv17l2 PE=1 SV=1
9	Q2QL34	1.16e-16	75.9	196	0.284	0.255	MP17L_HUMAN Mpv17-like protein OS=Homo sapiens OX=9606 GN=MPV17L PE=1 SV=1
10	O14142	1.18e-15	73.6	206	0.295	0.252	SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sym1 PE=3 SV=1
11	Q567V2	1.32e-15	73.2	206	0.261	0.223	M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2
12	Q9SJH9	7.79e-14	68.9	232	0.307	0.233	Q9SJH9_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g42770 PE=1 SV=2
13	Q9NR77	8.06e-14	68.2	195	0.273	0.246	PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens OX=9606 GN=PXMP2 PE=1 SV=3
14	Q07066	1.57e-13	67.4	194	0.250	0.227	PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Pxmp2 PE=1 SV=2
15	Q9VN75	4.27e-13	66.2	193	0.199	0.181	Q9VN75_DROME IP08061p OS=Drosophila melanogaster OX=7227 GN=plh PE=2 SV=2
16	P42925	2.73e-12	64.3	194	0.227	0.206	PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus OX=10090 GN=Pxmp2 PE=1 SV=2
17	Q08743	2.58e-10	60.1	309	0.205	0.117	YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR292C PE=1 SV=1
18	Q10244	1.92e-09	57.0	221	0.256	0.204	YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.14 PE=3 SV=1
19	B5MC10	3.93e-07	48.1	99	0.125	0.222	B5MC10_HUMAN Mitochondrial inner membrane protein MPV17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1
20	Q9W0B2	1.33e-04	42.7	191	0.210	0.194	Q9W0B2_DROME LD19311p OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.268 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04117 Mpv17_PMP22	3.9e-18	76.7	Mpv17 / PMP22 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003962

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009479	0.809	Uncharacterized protein
2	61853.ENSNLEP00000018444	0.701	Mitochondrial transcription termination factor 1
3	61853.ENSNLEP00000000380	0.700	Deoxyguanosine kinase
4	61853.ENSNLEP00000001930	0.691	Transmembrane protein 70
5	61853.ENSNLEP00000015757	0.671	arginyl-tRNA synthetase 2, mitochondrial
6	61853.ENSNLEP00000013908	0.652	enoyl-CoA delta isomerase 2
7	61853.ENSNLEP00000014192	0.645	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
8	61853.ENSNLEP00000003577	0.643	succinate-CoA ligase, ADP-forming, beta subunit
9	61853.ENSNLEP00000021774	0.641	Catalase
10	61853.ENSNLEP00000014209	0.635	DNA polymerase gamma, catalytic subunit
11	61853.ENSNLEP00000017408	0.629	alpha-methylacyl-CoA racemase
12	61853.ENSNLEP00000013693	0.612	Trypsin domain containing 1
13	61853.ENSNLEP00000015879	0.610	SURF1-like protein
14	61853.ENSNLEP00000021841	0.608	Peroxisomal biogenesis factor 16
15	61853.ENSNLEP00000008290	0.595	D-amino-acid oxidase
16	61853.ENSNLEP00000015532	0.595	D-aspartate oxidase
17	61853.ENSNLEP00000006509	0.594	Hydroxyacid oxidase 2 (long chain)
18	61853.ENSNLEP00000017137	0.594	Hydroxyacid oxidase (glycolate oxidase) 1
19	61853.ENSNLEP00000019844	0.591	Epoxide hydrolase 2, cytoplasmic
20	61853.ENSNLEP00000021412	0.591	Carnitine O-acetyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005215	0.996	transporter activity
GO:0015267	0.993	channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071840	0.992	cellular component organization or biogenesis
GO:0065007	0.987	biological regulation
GO:0044237	0.947	cellular metabolic process
GO:0016043	0.932	cellular component organization
GO:0050794	0.914	regulation of cellular process
GO:0019222	0.897	regulation of metabolic process
GO:0031323	0.889	regulation of cellular metabolic process
GO:0080090	0.762	regulation of primary metabolic process
GO:0051171	0.726	regulation of nitrogen compound metabolic process
GO:0071704	0.611	organic substance metabolic process
GO:0060255	0.564	regulation of macromolecule metabolic process
GO:0019219	0.514	regulation of nucleobase-containing compound metabolic process
GO:0006996	0.494	organelle organization
GO:0044238	0.488	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005777	0.998	peroxisome
GO:0016020	0.992	membrane
GO:0005829	0.992	cytosol
GO:0070013	0.934	intracellular organelle lumen
GO:0031090	0.930	organelle membrane
GO:0005740	0.884	mitochondrial envelope
GO:0031966	0.609	mitochondrial membrane
GO:0098588	0.607	bounding membrane of organelle
GO:0019866	0.596	organelle inner membrane
GO:0005743	0.587	mitochondrial inner membrane
GO:0005778	0.498	peroxisomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]