StarFunc result for job id P39656

User Input

>input (456 residues)
MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETH
SLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFI
DGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENL
LKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKN
TLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRI
DPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAD5	0.899	0.899	4.797E-92	456	0.998	0.998	A0A024RAD5.pdb.gz
2	AFDB:Q24319	0.865	0.878	1.018E-68	449	0.561	0.570	Q24319.pdb.gz	OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster OX=7227 GN=Ost48 PE=2 SV=2
3	AFDB:Q944K2	0.863	0.899	4.326E-61	437	0.430	0.449	Q944K2.pdb.gz	OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana OX=3702 GN=OST48 PE=2 SV=1
4	AFDB:O59866	0.759	0.789	1.969E-44	437	0.281	0.293	O59866.pdb.gz	OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wbp1 PE=2 SV=2
5	AFDB:P33767	0.758	0.801	2.311E-36	430	0.226	0.240	P33767.pdb.gz	OSTB_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WBP1 PE=1 SV=1
6	AFDB:A0A1D8PF22	0.754	0.785	5.335E-36	437	0.232	0.243	A0A1D8PF22.pdb.gz	A0A1D8PF22_CANAL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=WBP1 PE=3 SV=1
7	AFDB:Q5B926	0.329	0.181	5.448E-7	912	0.086	0.043	Q5B926.pdb.gz	Q5B926_EMENI Extracellular serine-rich protein, putative (AFU_orthologue AFUA_3G07870) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02954 PE=4 SV=1
8	AFDB:O95803	0.265	0.152	9.901E-7	873	0.064	0.033	O95803.pdb.gz	NDST3_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 OS=Homo sapiens OX=9606 GN=NDST3 PE=1 SV=1
9	AFDB:Q9EQW8	0.266	0.154	1.417E-6	872	0.066	0.034	Q9EQW8.pdb.gz	NDST4_MOUSE Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4 OS=Mus musculus OX=10090 GN=Ndst4 PE=2 SV=2
10	AFDB:P52848	0.293	0.168	2.575E-6	882	0.072	0.037	P52848.pdb.gz	NDST1_HUMAN Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 OS=Homo sapiens OX=9606 GN=NDST1 PE=1 SV=1
11	PDB:4nehA	0.147	0.075	9.795E-5	1084	0.149	0.063	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
12	PDB:2vxoB	0.274	0.200	7.035E-4	658	0.055	0.038	2vxoB.pdb.gz	Substrate Specificity and Oligomerization of Human Gmp Synthetase
13	PDB:7tvzE	0.152	0.110	8.935E-4	665	0.050	0.035	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
14	PDB:4nenA	0.141	0.071	2.189E-3	1063	0.145	0.062	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
15	PDB:4rtdA	0.165	0.072	2.780E-3	1122	0.033	0.013	4rtdA.pdb.gz
16	PDB:1ys6B	0.133	0.240	4.760E-3	227	0.044	0.088	1ys6B.pdb.gz	Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
17	PDB:6pk4A	0.257	0.220	5.053E-3	559	0.081	0.066	6pk4A.pdb.gz	Coupled structural transitions enable highly cooperative regulation of human CTPS2 filaments.
18	PDB:1kxjA	0.242	0.466	6.045E-3	203	0.048	0.108	1kxjA.pdb.gz
19	PDB:5douD	0.193	0.075	6.045E-3	1430	0.061	0.020	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
20	PDB:7ea3J	0.156	0.097	6.045E-3	883	0.107	0.055	7ea3J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DGS1	0.0	899	439	0.963	1.000	A0A0C4DGS1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=1
2	P39656	0.0	937	456	1.000	1.000	OST48_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4
3	Q05052	0.0	858	445	0.932	0.955	OST48_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Canis lupus familiaris OX=9615 GN=DDOST PE=1 SV=1
4	Q24319	0.0	541	449	0.577	0.586	OST48_DROME Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Drosophila melanogaster OX=7227 GN=Ost48 PE=2 SV=2
5	Q641Y0	0.0	852	441	0.921	0.952	OST48_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ddost PE=2 SV=1
6	Q944K2	1.48e-127	378	437	0.436	0.455	OST48_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Arabidopsis thaliana OX=3702 GN=OST48 PE=2 SV=1
7	O59866	1.86e-61	208	437	0.281	0.293	OSTB_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit wbp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wbp1 PE=2 SV=2
8	P33767	3.02e-29	120	430	0.230	0.244	OSTB_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WBP1 PE=1 SV=1
9	A0A1D8PF22	4.11e-27	115	437	0.232	0.243	A0A1D8PF22_CANAL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=WBP1 PE=3 SV=1
10	Q580D1	4.8	31.6	275	0.059	0.098	Q580D1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.440 PE=4 SV=1
11	P51884	9.3	30.8	338	0.059	0.080	LUM_HUMAN Lumican OS=Homo sapiens OX=9606 GN=LUM PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03345 DDOST_48kD	2.8e-146	499.0	Oligosaccharyltransferase 48 kDa subunit beta

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237530	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
2	9606.ENSP00000250498	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
3	9606.ENSP00000295770	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
4	9606.ENSP00000296255	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
5	9606.ENSP00000354649	0.999	Magnesium transporter protein 1
6	9606.ENSP00000376472	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
7	9606.ENSP00000457935	0.999	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4
8	9606.ENSP00000443216	0.998	Transmembrane protein 258
9	9606.ENSP00000424544	0.997	Tumor suppressor candidate 3
10	9606.ENSP00000426167	0.993	Oligosaccharyltransferase complex subunit OSTC
11	9606.ENSP00000223641	0.988	Protein transport protein Sec61 subunit beta
12	9606.ENSP00000243253	0.984	Protein transport protein Sec61 subunit alpha isoform 1
13	9606.ENSP00000233616	0.974	Mannosyl-oligosaccharide glucosidase
14	9606.ENSP00000247461	0.973	Calnexin
15	9606.ENSP00000228506	0.972	Malectin
16	9606.ENSP00000295682	0.967	Keratinocyte-associated protein 2
17	9606.ENSP00000317331	0.962	Translocon-associated protein subunit delta
18	9606.ENSP00000298428	0.958	Protein transport protein Sec61 subunit alpha isoform 2
19	9606.ENSP00000266483	0.956	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
20	9606.ENSP00000265044	0.948	Translocon-associated protein subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008047	0.999	enzyme activator activity
GO:0003824	0.402	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:1901564	0.980	organonitrogen compound metabolic process
GO:0019538	0.961	protein metabolic process
GO:0044260	0.910	cellular macromolecule metabolic process
GO:1901135	0.907	carbohydrate derivative metabolic process
GO:1901576	0.905	organic substance biosynthetic process
GO:0044249	0.905	cellular biosynthetic process
GO:0036211	0.903	protein modification process
GO:1901566	0.899	organonitrogen compound biosynthetic process
GO:1901137	0.877	carbohydrate derivative biosynthetic process
GO:0009100	0.844	glycoprotein metabolic process
GO:0009059	0.821	macromolecule biosynthetic process
GO:0034645	0.793	cellular macromolecule biosynthetic process
GO:0070085	0.717	glycosylation
GO:0006486	0.711	protein glycosylation
GO:0006487	0.608	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.997	endoplasmic reticulum membrane
GO:0140534	0.976	endoplasmic reticulum protein-containing complex
GO:0098796	0.973	membrane protein complex
GO:1902494	0.972	catalytic complex
GO:1990234	0.911	transferase complex
GO:0071944	0.885	cell periphery
GO:0008250	0.848	oligosaccharyltransferase complex
GO:0005886	0.673	plasma membrane
GO:0031982	0.318	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]