StarFunc result for job id P39748

User Input

>input (380 residues)
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39748	1.000	1.000	2.693E-65	380	1.000	1.000	P39748.pdb.gz	FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1
2	AFDB:P70040	0.934	0.929	1.144E-55	382	0.803	0.798	P70040.pdb.gz	FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis OX=8355 GN=fen1-a PE=1 SV=1
3	AFDB:Q6TNU4	0.917	0.917	1.629E-54	380	0.771	0.771	Q6TNU4.pdb.gz	FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio OX=7955 GN=fen1 PE=2 SV=1
4	AFDB:Q9N3T2	0.913	0.909	1.847E-47	382	0.597	0.594	Q9N3T2.pdb.gz	FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=crn-1 PE=1 SV=1
5	PDB:1ul1Z	0.855	0.928	1.727E-45	349	0.918	1.000	1ul1Z.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
6	AFDB:P39750	0.917	0.917	4.366E-45	380	0.550	0.550	P39750.pdb.gz	FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad2 PE=1 SV=1
7	AFDB:Q9SXQ6	0.918	0.918	6.570E-45	380	0.521	0.521	Q9SXQ6.pdb.gz	FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica OX=39947 GN=FEN1A PE=1 SV=1
8	AFDB:F4K191	0.912	0.766	6.887E-44	453	0.511	0.428	F4K191.pdb.gz	F4K191_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SAV6 PE=1 SV=1
9	PDB:1ul1X	0.746	0.901	1.397E-43	313	0.824	1.000	1ul1X.pdb.gz	Structural basis for recruitment of human flap endonuclease 1 to PCNA
10	AFDB:P26793	0.884	0.879	4.332E-43	382	0.561	0.558	P26793.pdb.gz	FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD27 PE=1 SV=1
11	AFDB:Q57WW6	0.905	0.876	7.996E-43	393	0.482	0.466	Q57WW6.pdb.gz	FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=FEN1 PE=3 SV=1
12	AFDB:Q7K734	0.905	0.516	6.145E-41	672	0.471	0.266	Q7K734.pdb.gz	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1
13	PDB:5hnkA	0.381	0.498	9.845E-7	272	0.129	0.180	5hnkA.pdb.gz	Direct observation of DNA threading in flap endonuclease complexes.
14	PDB:1xo1A	0.355	0.517	3.029E-6	245	0.113	0.176	1xo1A.pdb.gz
15	PDB:3h7iA	0.349	0.409	2.558E-2	302	0.108	0.136	3h7iA.pdb.gz
16	PDB:2bneB	0.174	0.263	4.246E-1	238	0.055	0.088	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
17	PDB:2j5tH	0.166	0.185	4.949E-1	337	0.063	0.071	2j5tH.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
18	PDB:2j5tD	0.160	0.166	5.209E-1	365	0.066	0.068	2j5tD.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
19	PDB:7dlwB	0.146	0.137	5.209E-1	419	0.097	0.088	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.
20	PDB:2v5hB	0.154	0.197	5.769E-1	289	0.066	0.087	2v5hB.pdb.gz	The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39748	0.0	782	380	1.000	1.000	FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1
2	P39749	0.0	723	378	0.955	0.960	FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus OX=10090 GN=Fen1 PE=1 SV=1
3	P70040	0.0	621	382	0.803	0.798	FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis OX=8355 GN=fen1-a PE=1 SV=1
4	P70054	0.0	620	382	0.808	0.804	FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis OX=8355 GN=fen1-b PE=1 SV=1
5	Q5XIP6	0.0	759	380	0.963	0.963	FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus OX=10116 GN=Fen1 PE=2 SV=1
6	Q6FHX6	0.0	782	380	1.000	1.000	Q6FHX6_HUMAN Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=2 SV=1
7	Q6TNU4	0.0	612	380	0.771	0.771	FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio OX=7955 GN=fen1 PE=2 SV=1
8	Q9N3T2	1.53e-168	478	382	0.597	0.594	FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans OX=6239 GN=crn-1 PE=1 SV=1
9	P39750	1.01e-154	442	380	0.553	0.553	FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad2 PE=1 SV=1
10	P26793	2.81e-151	434	382	0.563	0.560	FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD27 PE=1 SV=1
11	F4K191	1.87e-144	419	453	0.521	0.437	F4K191_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SAV6 PE=1 SV=1
12	Q9SXQ6	4.61e-139	402	380	0.513	0.513	FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica OX=39947 GN=FEN1A PE=1 SV=1
13	Q57WW6	1.99e-128	376	393	0.471	0.455	FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=FEN1 PE=3 SV=1
14	Q7K734	2.03e-115	352	672	0.468	0.265	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1
15	Q17RS7	1.09e-24	108	908	0.187	0.078	GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens OX=9606 GN=GEN1 PE=1 SV=2
16	A0A1D8PLU8	6.05e-23	103	990	0.176	0.068	A0A1D8PLU8_CANAL SsDNA endodeoxyribonuclease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD2 PE=3 SV=1
17	Q9LPD2	3.75e-22	100	599	0.200	0.127	GENL1_ARATH Flap endonuclease GEN-like 1 OS=Arabidopsis thaliana OX=3702 GN=GEN1 PE=1 SV=3
18	Q64MA3	2.78e-21	97.8	629	0.187	0.113	GENL1_ORYSJ Flap endonuclease GEN-like 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAD PE=1 SV=1
19	Q8L6Z7	3.42e-21	97.8	735	0.258	0.133	EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=EXO1 PE=2 SV=2
20	Q9UQ84	6.25e-20	94.0	846	0.237	0.106	EXO1_HUMAN Exonuclease 1 OS=Homo sapiens OX=9606 GN=EXO1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01367 5_3_exonuc	0.001	31.0	5'-3' exonuclease, C-terminal SAM fold
2	PF14520 HHH_5	1.7e+02	14.2	Helix-hairpin-helix domain
3	PF00867 XPG_I	5.4e-26	102.2	XPG I-region
4	PF00752 XPG_N	1.5e-34	129.9	XPG N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
2	9606.ENSP00000263274	0.998	DNA ligase 1
3	9606.ENSP00000298139	0.998	Werner syndrome ATP-dependent helicase
4	9606.ENSP00000406046	0.998	DNA polymerase delta catalytic subunit
5	9606.ENSP00000351185	0.997	DNA replication ATP-dependent helicase/nuclease DNA2
6	9606.ENSP00000264156	0.993	DNA replication licensing factor MCM6
7	9606.ENSP00000216714	0.992	DNA-(apurinic or apyrimidinic site) lyase
8	9606.ENSP00000234420	0.989	DNA mismatch repair protein Msh6
9	9606.ENSP00000368349	0.989	DNA polymerase alpha catalytic subunit
10	9606.ENSP00000262105	0.988	DNA replication licensing factor MCM4
11	9606.ENSP00000265056	0.988	DNA replication licensing factor MCM2
12	9606.ENSP00000265465	0.988	DNA polymerase alpha subunit B
13	9606.ENSP00000350491	0.988	DNA primase small subunit
14	9606.ENSP00000480987	0.988	DNA replication licensing factor MCM3
15	9606.ENSP00000480186	0.987	DNA polymerase delta subunit 2
16	9606.ENSP00000233146	0.986	DNA mismatch repair protein Msh2
17	9606.ENSP00000216122	0.985	DNA replication licensing factor MCM5
18	9606.ENSP00000224140	0.985	Probable helicase senataxin
19	9606.ENSP00000347170	0.985	Endonuclease 8-like 1
20	9606.ENSP00000376272	0.985	Replication factor C subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004527	0.999	exonuclease activity
GO:0017108	0.998	5'-flap endonuclease activity
GO:0008409	0.986	5'-3' exonuclease activity
GO:1901363	0.985	heterocyclic compound binding
GO:0097159	0.985	organic cyclic compound binding
GO:0003676	0.983	nucleic acid binding
GO:0003677	0.968	DNA binding
GO:0003690	0.802	double-stranded DNA binding
GO:0016796	0.609	exonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
GO:0016895	0.596	DNA exonuclease activity, producing 5'-phosphomonoesters
GO:0003684	0.444	damaged DNA binding
GO:0004521	0.416	RNA endonuclease activity
GO:0016891	0.404	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0004523	0.314	RNA-DNA hybrid ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0050896	0.987	response to stimulus
GO:0006807	0.984	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0044260	0.968	cellular macromolecule metabolic process
GO:0090304	0.967	nucleic acid metabolic process
GO:0006260	0.963	DNA replication
GO:0051716	0.947	cellular response to stimulus
GO:0006974	0.932	cellular response to DNA damage stimulus
GO:0006281	0.897	DNA repair
GO:0065007	0.729	biological regulation
GO:0050789	0.682	regulation of biological process
GO:0050794	0.660	regulation of cellular process
GO:0071840	0.470	cellular component organization or biogenesis
GO:0016043	0.369	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005654	0.966	nucleoplasm
GO:0032991	0.656	protein-containing complex
GO:0005694	0.605	chromosome
GO:0005737	0.580	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.21.-	0.998	Endodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.15.-	0.609	Exonucleases active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters.
EC:3.1.11.-	0.596	Exodeoxyribonucleases producing 5'-phosphomonoesters.
EC:3.1.26.-	0.404	Endoribonucleases producing 5'-phosphomonoesters.
EC:3.1.26.4	0.314	ribonuclease H.

[back to server]