StarFunc result for job id P39880

User Input

>input (1505 residues)
MLCVAGARLKRELDATATVLANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSF
QGEIDALSKRSKEAEAAFLNVYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRE
TLEEYNKEFAEVKNQEVTIKALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQ
ETQMSTTSKLEEAEHKVQSLQTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERAN
QRAEVAQREAETLREQLSSANHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIA
QLVEDVQRLQASLTKLRENSASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNI
LKSMEFAPSEGAGTQDAAKPLEVLLLEKNRSLQSENAALRISNSDLSGSARRKGKDQPES
RRPGSLPAPPPSQLPRNPGEQASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFAL
NSLLQRQLMQSFYSKAMQEAGSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSE
SAGSVSEGEEMDTAEIARQVKEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLT
VRGKEPFHKMKQFLSDEQNILALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRI
RASETGSDEAIKSILEQAKRELQVQKTAEPAQPSSASGSGNSDDAIRSILQQARREMEAQ
QAALDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPN
PPALKKEAQDAPGLDPQGAADCAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEE
AKAEETGGGKEKGSGGSGGGSQPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGA
SRSETPQNSPLPSSPIVPMSKPTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNG
ICQRIFGEKVLGLSQGSVSDMLSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQ
QQGPVLHSVTSLQDPLQQGCVSSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPP
IEASKDSKPPEPSDPPASDSQPTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLT
DNNLGQRLFGETILGLTQGSVSDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMD
MKRMEKKAYMKRRHSSVSDSQPCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALK
RAYQQKPYPSPKTIEDLATQLNLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASD
SPSARSGRAAPSSEGDSCDGVEATEGPGSADTEEPKSQGEAEREEVPRPAEQTEPPPSGT
PGPDDARDDDHEGGPVEGPGPLPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPP
PSNSSSSSAPRRPSSLQSLFGLPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEP
IEWEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39880	1.000	1.000	0.000	1505	1.000	1.000	P39880.pdb.gz	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
2	AFDB:P53564	0.296	0.294	0.000	1515	0.899	0.893	P53564.pdb.gz	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
3	AFDB:P53565	0.173	0.173	0.000	1504	0.876	0.877	P53565.pdb.gz	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
4	AFDB:Q9NJB5	0.058	0.074	6.337E-10	1081	0.110	0.153	Q9NJB5.pdb.gz	ONEC_DROME Homeobox protein onecut OS=Drosophila melanogaster OX=7227 GN=onecut PE=2 SV=2
5	AFDB:I0J0E7	0.084	0.099	5.333E-5	1217	0.096	0.119	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
6	AFDB:O57602	0.057	0.119	6.862E-5	623	0.060	0.146	O57602.pdb.gz	O57602_ICTPU POU domain protein OS=Ictalurus punctatus OX=7998 GN=Oct1 PE=2 SV=1
7	AFDB:A0A166B1A6	0.085	0.109	7.590E-5	1119	0.098	0.131	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
8	AFDB:Q9CA42	0.076	0.098	9.285E-5	1085	0.091	0.126	Q9CA42.pdb.gz	CRWN3_ARATH Protein CROWDED NUCLEI 3 OS=Arabidopsis thaliana OX=3702 GN=CRWN3 PE=1 SV=1
9	AFDB:P19246	0.073	0.094	1.043E-3	1090	0.120	0.166	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
10	AFDB:Q5EE04	0.060	0.047	1.343E-3	1997	0.136	0.102	Q5EE04.pdb.gz	TPR_XENLA Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1
11	PDB:4egcA	0.042	0.096	4.064E-2	539	0.025	0.071	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.036	0.597	9.726E-1	73	0.007	0.151	2hi3A.pdb.gz
13	PDB:6cf1B	0.035	0.463	1.023	94	0.011	0.170	6cf1B.pdb.gz
14	PDB:6dv9F	0.033	0.209	1.384	174	0.019	0.167	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
15	PDB:6jcxF	0.026	0.169	2.071	186	0.022	0.177	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
16	PDB:3bdnA	0.031	0.160	2.179	234	0.011	0.073	3bdnA.pdb.gz	Crystal structure of the lambda repressor and a model for pairwise cooperative operator binding
17	PDB:3f51A	0.037	0.430	2.410	94	0.005	0.085	3f51A.pdb.gz
18	PDB:7o4iW	0.022	0.094	3.260	312	0.021	0.099	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:1ohhG	0.024	0.260	5.676	94	0.011	0.170	1ohhG.pdb.gz	The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1
20	PDB:5x6cA	0.022	0.055	6.278	539	0.007	0.019	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y852	0.0	2844	1460	0.950	0.979	A0A2R8Y852_HUMAN Homeobox protein cut-like OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=1
2	A0A2R8YDI1	0.0	2177	1358	0.767	0.850	A0A2R8YDI1_HUMAN Homeobox protein cut-like OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=1
3	O14529	0.0	671	1486	0.271	0.275	CUX2_HUMAN Homeobox protein cut-like 2 OS=Homo sapiens OX=9606 GN=CUX2 PE=1 SV=4
4	P39880	0.0	3034	1505	1.000	1.000	CUX1_HUMAN Homeobox protein cut-like 1 OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=3
5	P53564	0.0	2577	1515	0.896	0.890	CUX1_MOUSE Homeobox protein cut-like 1 OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=3
6	P53565	0.0	2519	1504	0.879	0.880	CUX1_RAT Homeobox protein cut-like 1 OS=Rattus norvegicus OX=10116 GN=Cux1 PE=1 SV=2
7	P70403	0.0	759	678	0.256	0.569	CASP_MOUSE Protein CASP OS=Mus musculus OX=10090 GN=Cux1 PE=1 SV=2
8	Q13948	0.0	780	678	0.265	0.588	CASP_HUMAN Protein CASP OS=Homo sapiens OX=9606 GN=CUX1 PE=1 SV=2
9	P70298	4.01e-133	450	1426	0.205	0.216	CUX2_MOUSE Homeobox protein cut-like 2 OS=Mus musculus OX=10090 GN=Cux2 PE=2 SV=2
10	P10180	5.97e-47	188	2175	0.060	0.042	CUT_DROME Homeobox protein cut OS=Drosophila melanogaster OX=7227 GN=ct PE=1 SV=1
11	Q9LS42	5.92e-44	174	689	0.080	0.174	CASP_ARATH Protein CASP OS=Arabidopsis thaliana OX=3702 GN=CASP PE=1 SV=2
12	P34237	1.59e-18	94.0	679	0.077	0.171	CASP_YEAST Protein CASP OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COY1 PE=1 SV=2
13	O08755	8.31e-13	75.1	465	0.035	0.112	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
14	P70512	8.53e-13	75.1	465	0.035	0.112	HNF6_RAT Hepatocyte nuclear factor 6 OS=Rattus norvegicus OX=10116 GN=Onecut1 PE=1 SV=1
15	Q9UBC0	1.06e-12	74.7	465	0.036	0.116	HNF6_HUMAN Hepatocyte nuclear factor 6 OS=Homo sapiens OX=9606 GN=ONECUT1 PE=2 SV=1
16	O60422	1.10e-12	74.7	494	0.039	0.119	ONEC3_HUMAN One cut domain family member 3 OS=Homo sapiens OX=9606 GN=ONECUT3 PE=1 SV=2
17	Q8K557	2.86e-12	73.6	490	0.035	0.106	ONEC3_MOUSE One cut domain family member 3 OS=Mus musculus OX=10090 GN=Onecut3 PE=1 SV=2
18	Q6NYT7	3.00e-12	73.2	456	0.035	0.116	Q6NYT7_DANRE One cut domain family member OS=Danio rerio OX=7955 GN=oc1 PE=2 SV=1
19	Q6PHC9	6.45e-12	72.0	461	0.034	0.111	Q6PHC9_DANRE One cut domain family member OS=Danio rerio OX=7955 GN=oc1 PE=2 SV=1
20	Q6XBJ3	3.38e-11	70.1	505	0.035	0.105	ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus OX=10090 GN=Onecut2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02376 CUT	2.8e-79	272.6	CUT domain
2	PF17733 DUF5572	7.3	17.8	Family of unknown function (DUF5572)
3	PF05920 Homeobox_KN	0.038	25.2	Homeobox KN domain
4	PF00046 Homeodomain	1.9e-11	54.9	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263102	0.944	Coiled-coil domain containing 6
2	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
3	9606.ENSP00000362649	0.932	Histone deacetylase 1
4	9606.ENSP00000163416	0.912	Golgin subfamily A member 5
5	9606.ENSP00000341208	0.908	Signal transducer and activator of transcription 5A
6	9606.ENSP00000293328	0.907	Signal transducer and activator of transcription 5B
7	9606.ENSP00000306496	0.902	Ras-related protein Rab-33B
8	9606.ENSP00000307078	0.890	Kinesin-1 heavy chain
9	9606.ENSP00000463027	0.878	Nuclear receptor coactivator 4
10	9606.ENSP00000374205	0.866	T-box brain protein 1
11	9606.ENSP00000349723	0.842	B-cell lymphoma/leukemia 11B
12	9606.ENSP00000355812	0.839	FGFR1 oncogene partner
13	9606.ENSP00000365720	0.809	Transducin-like enhancer protein 4
14	9606.ENSP00000294179	0.805	Syntaxin-5
15	9606.ENSP00000401112	0.804	DNA-binding protein SATB2
16	9606.ENSP00000225724	0.794	Golgi SNAP receptor complex member 1
17	9606.ENSP00000258654	0.792	Conserved oligomeric Golgi complex subunit 3
18	9606.ENSP00000218249	0.788	Ras-related protein Rab-40A-like
19	9606.ENSP00000264710	0.788	Ras-related protein Rab-10
20	9606.ENSP00000267512	0.788	Ras-related protein Rab-15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0005515	0.945	protein binding
GO:0140110	0.532	transcription regulator activity
GO:0000977	0.413	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003700	0.395	DNA-binding transcription factor activity
GO:0000981	0.319	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.305	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048523	0.946	negative regulation of cellular process
GO:0045934	0.940	negative regulation of nucleobase-containing compound metabolic process
GO:0000122	0.906	negative regulation of transcription by RNA polymerase II
GO:0009987	0.893	cellular process
GO:0032502	0.560	developmental process
GO:0048856	0.551	anatomical structure development
GO:0048518	0.541	positive regulation of biological process
GO:0032501	0.444	multicellular organismal process
GO:0048522	0.437	positive regulation of cellular process
GO:0007275	0.379	multicellular organism development
GO:0051179	0.329	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0031981	0.995	nuclear lumen
GO:0005794	0.994	Golgi apparatus
GO:0005654	0.994	nucleoplasm
GO:0005829	0.894	cytosol
GO:0016020	0.832	membrane
GO:0031090	0.520	organelle membrane
GO:0098588	0.386	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]