StarFunc result for job id P39900

User Input

>input (470 residues)
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLM
KEKIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITYRINN
YTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGI
LAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTY
KYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF
FKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRP
EPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITK
NFQGIGPKIDAVFYSKNKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39900	1.000	1.000	5.466E-100	470	1.000	1.000	P39900.pdb.gz	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
2	AFDB:Q63341	0.875	0.884	4.067E-73	465	0.630	0.637	Q63341.pdb.gz	MMP12_RAT Macrophage metalloelastase OS=Rattus norvegicus OX=10116 GN=Mmp12 PE=2 SV=1
3	AFDB:P34960	0.709	0.706	7.891E-72	473	0.619	0.615	P34960.pdb.gz	MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus OX=10090 GN=Mmp12 PE=1 SV=3
4	AFDB:P08254	0.517	0.509	7.186E-65	477	0.506	0.499	P08254.pdb.gz	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
5	AFDB:P09238	0.519	0.512	8.055E-65	476	0.502	0.496	P09238.pdb.gz	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
6	AFDB:P28862	0.510	0.503	1.201E-64	477	0.513	0.505	P28862.pdb.gz	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
7	AFDB:P03957	0.512	0.507	7.034E-64	475	0.515	0.509	P03957.pdb.gz	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
8	AFDB:O55123	0.496	0.490	1.655E-63	476	0.502	0.496	O55123.pdb.gz	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
9	AFDB:Q9H306	0.504	0.463	3.399E-62	513	0.472	0.433	Q9H306.pdb.gz	MMP27_HUMAN Matrix metalloproteinase-27 OS=Homo sapiens OX=9606 GN=MMP27 PE=1 SV=2
10	AFDB:P22894	0.506	0.509	9.486E-62	467	0.466	0.469	P22894.pdb.gz	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
11	PDB:1su3B	0.451	0.508	1.399E-57	416	0.464	0.524	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
12	PDB:1gxdA	0.481	0.387	2.283E-40	624	0.404	0.304	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:2mzeA	0.459	0.830	2.447E-22	250	0.251	0.472	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.349	0.683	7.590E-11	227	0.094	0.194	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:1aklA	0.247	0.247	7.373E-7	470	0.096	0.096	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
16	PDB:5c2vB	0.217	0.273	7.373E-7	352	0.036	0.048	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
17	PDB:2h9lA	0.232	0.312	7.805E-7	321	0.045	0.065	2h9lA.pdb.gz
18	PDB:5yzgs	0.230	0.272	1.836E-6	374	0.036	0.045	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:1af0A	0.241	0.241	1.944E-6	470	0.089	0.089	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
20	PDB:5mzhB	0.189	0.208	2.442E-6	415	0.034	0.039	5mzhB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34960	0.0	580	473	0.621	0.617	MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus OX=10090 GN=Mmp12 PE=1 SV=3
2	P39900	0.0	979	470	1.000	1.000	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
3	Q63341	0.0	580	465	0.615	0.622	MMP12_RAT Macrophage metalloelastase OS=Rattus norvegicus OX=10116 GN=Mmp12 PE=2 SV=1
4	P28862	4.26e-168	484	477	0.517	0.509	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
5	P08254	3.53e-167	481	477	0.521	0.514	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
6	P03957	1.10e-164	475	475	0.523	0.518	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
7	O55123	3.30e-163	471	476	0.506	0.500	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
8	P09238	5.27e-158	458	476	0.498	0.492	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
9	P03956	1.41e-153	446	469	0.477	0.478	MMP1_HUMAN Interstitial collagenase OS=Homo sapiens OX=9606 GN=MMP1 PE=1 SV=3
10	P22894	4.94e-150	437	467	0.470	0.473	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
11	Q9H306	1.07e-148	436	513	0.481	0.441	MMP27_HUMAN Matrix metalloproteinase-27 OS=Homo sapiens OX=9606 GN=MMP27 PE=1 SV=2
12	O70138	5.22e-147	429	465	0.462	0.467	MMP8_MOUSE Neutrophil collagenase OS=Mus musculus OX=10090 GN=Mmp8 PE=2 SV=2
13	P45452	7.32e-144	422	471	0.468	0.467	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
14	O88766	1.64e-142	418	466	0.455	0.459	MMP8_RAT Neutrophil collagenase OS=Rattus norvegicus OX=10116 GN=Mmp8 PE=2 SV=1
15	P33435	2.49e-139	410	472	0.451	0.449	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
16	P23097	3.16e-137	405	466	0.457	0.461	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1
17	B5X4P7	1.34e-132	393	473	0.445	0.442	B5X4P7_SALSA Collagenase 3 OS=Salmo salar OX=8030 GN=MMP13 PE=2 SV=1
18	O60882	2.06e-132	393	483	0.445	0.433	MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens OX=9606 GN=MMP20 PE=1 SV=3
19	P57748	1.14e-130	389	482	0.447	0.436	MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus OX=10090 GN=Mmp20 PE=2 SV=1
20	Q9DEE0	1.63e-130	388	475	0.438	0.434	Q9DEE0_ONCMY Matrix metalloproteinase OS=Oncorhynchus mykiss OX=8022 GN=mmp PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	0.94	20.6	Astacin (Peptidase family M12A)
2	PF00045 Hemopexin	1.6e-45	164.1	Hemopexin
3	PF12044 Metallopep	5.5	17.1	Putative peptidase family
4	PF00413 Peptidase_M10	1.3e-58	208.8	Matrixin
5	PF07998 Peptidase_M54	43	15.6	Peptidase family M54
6	PF10462 Peptidase_M66	1e+02	13.3	Peptidase M66
7	PF01471 PG_binding_1	5.9e-11	53.7	Putative peptidoglycan binding domain
8	PF13582 Reprolysin_3	0.57	22.1	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	6.2e+02	11.4	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	4.7e+02	12.3	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000458585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308938	0.952	Plasminogen
2	9606.ENSP00000339328	0.949	Urokinase plasminogen activator surface receptor
3	9606.ENSP00000387356	0.940	Aggrecan core protein
4	9606.ENSP00000347665	0.932	Collagen alpha-1(XVIII) chain
5	9606.ENSP00000264187	0.929	Nidogen-1
6	9606.ENSP00000325146	0.927	Collagen alpha-1(XII) chain
7	9606.ENSP00000363827	0.924	Basement membrane-specific heparan sulfate proteoglycan core protein
8	9606.ENSP00000264144	0.915	Laminin subunit gamma-2
9	9606.ENSP00000375778	0.915	Laminin subunit beta-3
10	9606.ENSP00000324532	0.914	Laminin subunit alpha-3
11	9606.ENSP00000351807	0.845	Elastin
12	9606.ENSP00000218388	0.805	Metalloproteinase inhibitor 1
13	9606.ENSP00000262768	0.739	Metalloproteinase inhibitor 2
14	9606.ENSP00000361405	0.724	Matrix metalloproteinase-9
15	9606.ENSP00000323929	0.701	Alpha-2-macroglobulin
16	9606.ENSP00000287814	0.692	Metalloproteinase inhibitor 4
17	9606.ENSP00000345344	0.685	Cathepsin L1
18	9606.ENSP00000266085	0.671	Metalloproteinase inhibitor 3
19	9606.ENSP00000263341	0.642	Interleukin-1 beta
20	9606.ENSP00000466090	0.638	Neutrophil elastase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0008270	0.999	zinc ion binding
GO:0004252	0.999	serine-type endopeptidase activity
GO:0005515	0.942	protein binding
GO:0044877	0.583	protein-containing complex binding
GO:0005509	0.495	calcium ion binding
GO:0005518	0.394	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0050896	0.975	response to stimulus
GO:0008152	0.941	metabolic process
GO:0043062	0.940	extracellular structure organization
GO:0022411	0.939	cellular component disassembly
GO:0030198	0.930	extracellular matrix organization
GO:0071704	0.923	organic substance metabolic process
GO:0032963	0.916	collagen metabolic process
GO:0044238	0.909	primary metabolic process
GO:0006807	0.903	nitrogen compound metabolic process
GO:1901564	0.839	organonitrogen compound metabolic process
GO:0043170	0.832	macromolecule metabolic process
GO:0048518	0.829	positive regulation of biological process
GO:0048522	0.803	positive regulation of cellular process
GO:0019538	0.797	protein metabolic process
GO:0006508	0.793	proteolysis
GO:0022617	0.740	extracellular matrix disassembly
GO:0032502	0.712	developmental process
GO:0048856	0.697	anatomical structure development
GO:0032501	0.631	multicellular organismal process
GO:0042221	0.616	response to chemical
GO:0048519	0.614	negative regulation of biological process
GO:0051716	0.577	cellular response to stimulus
GO:0009056	0.556	catabolic process
GO:0019222	0.537	regulation of metabolic process
GO:0060255	0.466	regulation of macromolecule metabolic process
GO:0048523	0.457	negative regulation of cellular process
GO:0048583	0.454	regulation of response to stimulus
GO:0006950	0.453	response to stress
GO:0051171	0.439	regulation of nitrogen compound metabolic process
GO:0031323	0.419	regulation of cellular metabolic process
GO:0080090	0.406	regulation of primary metabolic process
GO:0051239	0.392	regulation of multicellular organismal process
GO:0042127	0.390	regulation of cell population proliferation
GO:0007275	0.390	multicellular organism development
GO:0009893	0.386	positive regulation of metabolic process
GO:0010604	0.371	positive regulation of macromolecule metabolic process
GO:0023051	0.338	regulation of signaling
GO:0010646	0.338	regulation of cell communication
GO:0010033	0.331	response to organic substance
GO:0048584	0.319	positive regulation of response to stimulus
GO:0010468	0.308	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.998	intracellular anatomical structure
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005737	0.972	cytoplasm
GO:0012505	0.874	endomembrane system
GO:0005634	0.863	nucleus
GO:0031982	0.467	vesicle
GO:0071944	0.333	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.
EC:3.4.21.-	0.999	Serine endopeptidases.

[back to server]