StarFunc result for job id P39905

User Input

>input (211 residues)
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL
TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR
PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39905	1.000	1.000	1.307E-34	211	1.000	1.000	P39905.pdb.gz	GDNF_HUMAN Glial cell line-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=GDNF PE=1 SV=1
2	AFDB:Q98TU0	0.433	0.395	1.329E-20	235	0.573	0.515	Q98TU0.pdb.gz	GDNF_DANRE Glial cell line-derived neurotrophic factor OS=Danio rerio OX=7955 GN=gdnf PE=1 SV=1
3	AFDB:Q99748	0.412	0.439	2.961E-12	197	0.299	0.320	Q99748.pdb.gz	NRTN_HUMAN Neurturin OS=Homo sapiens OX=9606 GN=NRTN PE=1 SV=1
4	AFDB:P97463	0.425	0.457	7.171E-12	195	0.299	0.323	P97463.pdb.gz	NRTN_MOUSE Neurturin OS=Mus musculus OX=10090 GN=Nrtn PE=1 SV=1
5	AFDB:Q5T4W7	0.403	0.388	7.150E-11	220	0.246	0.236	Q5T4W7.pdb.gz	ARTN_HUMAN Artemin OS=Homo sapiens OX=9606 GN=ARTN PE=1 SV=1
6	AFDB:Q6AYE8	0.391	0.371	1.018E-10	224	0.256	0.241	Q6AYE8.pdb.gz	ARTN_RAT Artemin OS=Rattus norvegicus OX=10116 GN=Artn PE=2 SV=1
7	AFDB:O70300	0.377	0.498	2.185E-9	156	0.213	0.288	O70300.pdb.gz	PSPN_MOUSE Persephin OS=Mus musculus OX=10090 GN=Pspn PE=2 SV=1
8	AFDB:O60542	0.380	0.501	7.106E-9	156	0.227	0.308	O60542.pdb.gz	PSPN_HUMAN Persephin OS=Homo sapiens OX=9606 GN=PSPN PE=2 SV=1
9	PDB:6q2sA	0.374	0.711	7.850E-8	98	0.166	0.357	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
10	PDB:5nxsA	0.270	0.206	3.193E-3	290	0.090	0.066	5nxsA.pdb.gz
11	PDB:5ntuA	0.295	0.209	8.699E-3	308	0.090	0.062	5ntuA.pdb.gz
12	PDB:3rjrC	0.272	0.174	1.664E-2	343	0.100	0.061	3rjrC.pdb.gz
13	PDB:2k8pA	0.256	0.280	2.667E-2	189	0.118	0.132	2k8pA.pdb.gz
14	PDB:4mqwB	0.274	0.463	3.183E-2	109	0.066	0.128	4mqwB.pdb.gz
15	PDB:5vqfB	0.278	0.192	3.799E-2	320	0.081	0.053	5vqfB.pdb.gz
16	AFDB:O95813	0.273	0.220	4.341E-2	267	0.156	0.124	O95813.pdb.gz	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
17	PDB:7t9iB	0.256	0.438	1.035E-1	109	0.071	0.138	7t9iB.pdb.gz
18	PDB:4my2A	0.258	0.126	1.564E-1	474	0.081	0.036	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
19	PDB:5hlyA	0.278	0.204	2.100E-1	299	0.100	0.070	5hlyA.pdb.gz
20	AFDB:O88271	0.159	0.123	2.262E-1	295	0.090	0.064	O88271.pdb.gz	CFDP1_MOUSE Craniofacial development protein 1 OS=Mus musculus OX=10090 GN=Cfdp1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39905	1.44e-157	436	211	1.000	1.000	GDNF_HUMAN Glial cell line-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=GDNF PE=1 SV=1
2	P48540	1.21e-126	357	211	0.929	0.929	GDNF_MOUSE Glial cell line-derived neurotrophic factor OS=Mus musculus OX=10090 GN=Gdnf PE=1 SV=1
3	Q07731	3.27e-125	354	211	0.929	0.929	GDNF_RAT Glial cell line-derived neurotrophic factor OS=Rattus norvegicus OX=10116 GN=Gdnf PE=1 SV=1
4	Q98TU0	1.29e-67	209	235	0.540	0.485	GDNF_DANRE Glial cell line-derived neurotrophic factor OS=Danio rerio OX=7955 GN=gdnf PE=1 SV=1
5	Q99748	4.91e-18	80.5	197	0.180	0.193	NRTN_HUMAN Neurturin OS=Homo sapiens OX=9606 GN=NRTN PE=1 SV=1
6	P97463	8.56e-18	79.7	195	0.180	0.195	NRTN_MOUSE Neurturin OS=Mus musculus OX=10090 GN=Nrtn PE=1 SV=1
7	Q811Q5	2.17e-17	78.6	195	0.180	0.195	Q811Q5_RAT Neurturin OS=Rattus norvegicus OX=10116 GN=Nrtn PE=3 SV=1
8	O60542	1.62e-14	70.1	156	0.185	0.250	PSPN_HUMAN Persephin OS=Homo sapiens OX=9606 GN=PSPN PE=2 SV=1
9	O70300	2.70e-14	69.7	156	0.180	0.244	PSPN_MOUSE Persephin OS=Mus musculus OX=10090 GN=Pspn PE=2 SV=1
10	Q5T4W7	1.40e-12	66.2	220	0.185	0.177	ARTN_HUMAN Artemin OS=Homo sapiens OX=9606 GN=ARTN PE=1 SV=1
11	Q6AYE8	2.21e-12	65.9	224	0.180	0.170	ARTN_RAT Artemin OS=Rattus norvegicus OX=10116 GN=Artn PE=2 SV=1
12	Q9Z0L2	2.42e-12	65.9	224	0.180	0.170	ARTN_MOUSE Artemin OS=Mus musculus OX=10090 GN=Artn PE=1 SV=1
13	O57574	0.020	37.7	400	0.161	0.085	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
14	E9QHW0	0.074	35.8	379	0.109	0.061	E9QHW0_DANRE Transforming growth factor beta OS=Danio rerio OX=7955 GN=tgfb1b PE=3 SV=1
15	Q9UK05	0.17	35.0	429	0.175	0.086	GDF2_HUMAN Growth/differentiation factor 2 OS=Homo sapiens OX=9606 GN=GDF2 PE=1 SV=1
16	G7PWZ3	0.23	34.3	308	0.137	0.094	GDF15_MACFA Growth/differentiation factor 15 OS=Macaca fascicularis OX=9541 GN=GDF15 PE=1 SV=1
17	P43026	0.66	33.1	501	0.123	0.052	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
18	P43027	0.72	33.1	495	0.147	0.063	GDF5_MOUSE Growth/differentiation factor 5 OS=Mus musculus OX=10090 GN=Gdf5 PE=1 SV=2
19	M0RAY4	0.73	33.1	495	0.147	0.063	M0RAY4_RAT Growth differentiation factor 5 OS=Rattus norvegicus OX=10116 GN=Gdf5 PE=3 SV=1
20	Q9WV56	0.86	32.7	428	0.152	0.075	GDF2_MOUSE Growth/differentiation factor 2 OS=Mus musculus OX=10090 GN=Gdf2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	1.1e-09	50.5	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347591	0.999	GDNF family receptor alpha-1
2	9606.ENSP00000347942	0.999	Proto-oncogene tyrosine-protein kinase receptor Ret
3	9606.ENSP00000431418	0.987	High affinity nerve growth factor receptor
4	9606.ENSP00000428518	0.985	GDNF family receptor alpha-2
5	9606.ENSP00000480132	0.980	Neural cell adhesion molecule 1
6	9606.ENSP00000256509	0.975	Neural cell adhesion molecule L1-like protein
7	9606.ENSP00000387699	0.972	Cyclic AMP-responsive element-binding protein 1
8	9606.ENSP00000360266	0.952	Transcription factor AP-1
9	9606.ENSP00000414303	0.950	Brain-derived neurotrophic factor
10	9606.ENSP00000372160	0.946	Docking protein 6
11	9606.ENSP00000401303	0.944	SHC-transforming protein 1
12	9606.ENSP00000261769	0.943	Cadherin-1
13	9606.ENSP00000344456	0.940	Catenin beta-1
14	9606.ENSP00000362680	0.939	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000262593	0.936	Docking protein 5
16	9606.ENSP00000447241	0.929	Fibroblast growth factor receptor substrate 2
17	9606.ENSP00000407586	0.923	GTPase HRas
18	9606.ENSP00000376345	0.922	Growth factor receptor-bound protein 2
19	9606.ENSP00000341189	0.920	Focal adhesion kinase 1
20	9606.ENSP00000378974	0.920	Mitogen-activated protein kinase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	1.000	protein dimerization activity
GO:0042802	1.000	identical protein binding
GO:0048018	1.000	receptor ligand activity
GO:0042803	0.993	protein homodimerization activity
GO:0042056	0.981	chemoattractant activity
GO:0005126	0.715	cytokine receptor binding
GO:1902379	0.527	chemoattractant activity involved in axon guidance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0032501	0.983	multicellular organismal process
GO:0048518	0.981	positive regulation of biological process
GO:0048856	0.980	anatomical structure development
GO:0023052	0.976	signaling
GO:0007154	0.976	cell communication
GO:0019222	0.971	regulation of metabolic process
GO:0051716	0.968	cellular response to stimulus
GO:2000027	0.962	regulation of animal organ morphogenesis
GO:0048522	0.959	positive regulation of cellular process
GO:0060688	0.959	regulation of morphogenesis of a branching structure
GO:1905330	0.956	regulation of morphogenesis of an epithelium
GO:0009719	0.954	response to endogenous stimulus
GO:1905332	0.952	positive regulation of morphogenesis of an epithelium
GO:0031325	0.952	positive regulation of cellular metabolic process
GO:0007399	0.951	nervous system development
GO:0001822	0.950	kidney development
GO:0051171	0.948	regulation of nitrogen compound metabolic process
GO:0009653	0.947	anatomical structure morphogenesis
GO:0051173	0.943	positive regulation of nitrogen compound metabolic process
GO:0030182	0.941	neuron differentiation
GO:0048519	0.939	negative regulation of biological process
GO:0042221	0.933	response to chemical
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0007165	0.929	signal transduction
GO:0071495	0.926	cellular response to endogenous stimulus
GO:0048523	0.926	negative regulation of cellular process
GO:0001656	0.917	metanephros development
GO:0080090	0.915	regulation of primary metabolic process
GO:0007167	0.910	enzyme-linked receptor protein signaling pathway
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0072073	0.905	kidney epithelium development
GO:0051240	0.902	positive regulation of multicellular organismal process
GO:2000026	0.901	regulation of multicellular organismal development
GO:0048583	0.886	regulation of response to stimulus
GO:0010941	0.884	regulation of cell death
GO:0010646	0.877	regulation of cell communication
GO:0023051	0.876	regulation of signaling
GO:0009966	0.870	regulation of signal transduction
GO:0044093	0.860	positive regulation of molecular function
GO:0060548	0.857	negative regulation of cell death
GO:0071840	0.855	cellular component organization or biogenesis
GO:0016043	0.854	cellular component organization
GO:0072006	0.838	nephron development
GO:0042981	0.835	regulation of apoptotic process
GO:0072009	0.807	nephron epithelium development
GO:0072028	0.802	nephron morphogenesis
GO:0043066	0.781	negative regulation of apoptotic process
GO:0010648	0.777	negative regulation of cell communication
GO:0051246	0.755	regulation of protein metabolic process
GO:0042127	0.747	regulation of cell population proliferation
GO:0010628	0.747	positive regulation of gene expression
GO:0072088	0.724	nephron epithelium morphogenesis
GO:0070887	0.717	cellular response to chemical stimulus
GO:0016477	0.697	cell migration
GO:0010033	0.697	response to organic substance
GO:0001823	0.694	mesonephros development
GO:0065008	0.680	regulation of biological quality
GO:0051252	0.675	regulation of RNA metabolic process
GO:0072164	0.673	mesonephric tubule development
GO:0048468	0.669	cell development
GO:1901214	0.667	regulation of neuron death
GO:0048585	0.667	negative regulation of response to stimulus
GO:0010605	0.656	negative regulation of macromolecule metabolic process
GO:0072078	0.649	nephron tubule morphogenesis
GO:0045595	0.648	regulation of cell differentiation
GO:0035850	0.640	epithelial cell differentiation involved in kidney development
GO:0051172	0.623	negative regulation of nitrogen compound metabolic process
GO:1901215	0.622	negative regulation of neuron death
GO:0031326	0.621	regulation of cellular biosynthetic process
GO:0010556	0.619	regulation of macromolecule biosynthetic process
GO:0043524	0.605	negative regulation of neuron apoptotic process
GO:0023057	0.552	negative regulation of signaling
GO:0032879	0.502	regulation of localization
GO:0060485	0.501	mesenchyme development
GO:0030030	0.490	cell projection organization
GO:0090183	0.484	regulation of kidney development
GO:0031324	0.465	negative regulation of cellular metabolic process
GO:0006355	0.452	regulation of DNA-templated transcription
GO:0009891	0.422	positive regulation of biosynthetic process
GO:0050790	0.406	regulation of catalytic activity
GO:0051049	0.379	regulation of transport
GO:0048584	0.376	positive regulation of response to stimulus
GO:0045893	0.361	positive regulation of DNA-templated transcription
GO:0007417	0.350	central nervous system development
GO:0071310	0.342	cellular response to organic substance
GO:0048666	0.310	neuron development
GO:0120036	0.307	plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.997	endomembrane system
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0032991	0.989	protein-containing complex
GO:0005737	0.987	cytoplasm
GO:0005615	0.895	extracellular space
GO:0005794	0.700	Golgi apparatus
GO:0016020	0.521	membrane
GO:0070013	0.387	intracellular organelle lumen
GO:0071944	0.320	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]