StarFunc result for job id P40121

User Input

>input (348 residues)
MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P24452	0.941	0.931	1.929E-68	352	0.914	0.903	P24452.pdb.gz	CAPG_MOUSE Macrophage-capping protein OS=Mus musculus OX=10090 GN=Capg PE=1 SV=2
2	PDB:1j72A	0.317	0.327	2.582E-54	337	0.914	0.944	1j72A.pdb.gz
3	AFDB:Q5ZIV9	0.933	0.460	9.008E-51	717	0.494	0.240	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
4	AFDB:E9PU64	0.917	0.453	6.217E-50	715	0.466	0.227	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
5	AFDB:A0A0R4IQ11	0.582	0.288	9.007E-48	720	0.460	0.222	A0A0R4IQ11.pdb.gz
6	AFDB:P06396	0.591	0.269	3.020E-46	782	0.480	0.214	P06396.pdb.gz	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
7	PDB:6jegB	0.578	0.285	2.737E-42	718	0.468	0.227	6jegB.pdb.gz
8	AFDB:P09327	0.592	0.259	4.207E-39	827	0.425	0.179	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
9	AFDB:O88398	0.587	0.254	6.338E-39	819	0.408	0.173	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
10	AFDB:O75366	0.579	0.252	1.617E-38	819	0.411	0.175	O75366.pdb.gz	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
11	AFDB:Q07171	0.613	0.274	2.167E-38	798	0.385	0.168	Q07171.pdb.gz	GELS_DROME Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2
12	AFDB:Q21253	0.605	0.448	4.046E-37	475	0.333	0.244	Q21253.pdb.gz	GELS1_CAEEL Gelsolin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=gsnl-1 PE=1 SV=1
13	PDB:7cccB	0.193	0.196	1.679E-5	342	0.086	0.088	7cccB.pdb.gz	The structure of the actin filament uncapping complex mediated by twinfilin.
14	PDB:5kynA	0.233	0.123	2.294E-3	730	0.080	0.038	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
15	PDB:1m2vA	0.199	0.108	3.885E-3	705	0.049	0.024	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
16	PDB:6zgaA	0.214	0.105	2.249E-2	751	0.037	0.017	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
17	PDB:7bk0B	0.108	0.141	1.093E-1	250	0.066	0.092	7bk0B.pdb.gz
18	PDB:4s2rP	0.127	0.082	1.228E-1	615	0.078	0.044	4s2rP.pdb.gz	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
19	PDB:1cofA	0.174	0.368	1.302E-1	135	0.043	0.111	1cofA.pdb.gz
20	PDB:1v6fA	0.186	0.363	1.464E-1	151	0.029	0.066	1v6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ENU9	0.0	526	253	0.727	1.000	E7ENU9_HUMAN Capping actin protein, gelsolin like (Fragment) OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=1
2	P24452	0.0	663	352	0.917	0.906	CAPG_MOUSE Macrophage-capping protein OS=Mus musculus OX=10090 GN=Capg PE=1 SV=2
3	P40121	0.0	724	348	1.000	1.000	CAPG_HUMAN Macrophage-capping protein OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=2
4	V9HW69	0.0	724	348	1.000	1.000	V9HW69_HUMAN Epididymis secretory protein Li 66 OS=Homo sapiens OX=9606 GN=HEL-S-66 PE=2 SV=1
5	B8ZZL6	2.30e-163	456	218	0.626	1.000	B8ZZL6_HUMAN Capping actin protein, gelsolin like (Fragment) OS=Homo sapiens OX=9606 GN=CAPG PE=1 SV=1
6	Q5ZIV9	3.65e-118	359	717	0.494	0.240	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
7	Q60604	7.65e-117	355	715	0.477	0.232	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3
8	P13020	9.72e-117	357	780	0.506	0.226	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
9	Q28046	6.85e-116	353	715	0.463	0.225	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
10	Q68FP1	8.18e-116	355	780	0.500	0.223	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
11	P20305	3.15e-114	350	772	0.494	0.223	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
12	G1U9R8	4.92e-114	349	739	0.494	0.233	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
13	E9PU64	9.06e-114	348	715	0.468	0.228	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
14	Q7TQ08	9.77e-114	348	715	0.468	0.228	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
15	P06396	1.67e-113	349	782	0.491	0.219	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
16	Q9Y6U3	4.30e-113	346	715	0.477	0.232	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
17	A0JMJ1	2.86e-112	344	720	0.457	0.221	A0JMJ1_DANRE Scinderin like a OS=Danio rerio OX=7955 GN=fb94b12 PE=1 SV=2
18	Q62468	1.65e-83	271	827	0.428	0.180	VILI_MOUSE Villin-1 OS=Mus musculus OX=10090 GN=Vil1 PE=1 SV=3
19	Q9WU06	2.40e-83	271	819	0.434	0.184	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
20	P09327	3.10e-81	265	827	0.420	0.177	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	1e-55	196.8	Gelsolin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264436	0.749	Beta-adducin
2	9606.ENSP00000264758	0.739	Alpha-adducin
3	9606.ENSP00000262428	0.731	Coactosin-like protein
4	9606.ENSP00000332449	0.728	Cysteine-rich protein 1
5	9606.ENSP00000401010	0.722	F-actin-capping protein subunit beta
6	9606.ENSP00000376800	0.720	Myotrophin
7	9606.ENSP00000389631	0.691	Actin-related protein 2/3 complex subunit 1B
8	9606.ENSP00000230085	0.684	Sorting nexin-3
9	9606.ENSP00000369786	0.678	Pirin
10	9606.ENSP00000286621	0.655	Adenosine kinase
11	9606.ENSP00000368970	0.645	Ubiquitin-fold modifier 1
12	9606.ENSP00000354947	0.631	F-actin-capping protein subunit alpha-2
13	9606.ENSP00000215754	0.612	Macrophage migration inhibitory factor
14	9606.ENSP00000484912	0.580	Calcyphosin
15	9606.ENSP00000381581	0.575	Plastin-2
16	9606.ENSP00000263168	0.561	F-actin-capping protein subunit alpha-1
17	9606.ENSP00000326238	0.551	F-actin-capping protein subunit alpha-3
18	9606.ENSP00000432660	0.549	Cofilin-1
19	9606.ENSP00000238618	0.516	Acylphosphatase-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050839	1.000	cell adhesion molecule binding
GO:0003779	0.999	actin binding
GO:0044877	0.998	protein-containing complex binding
GO:0019904	0.991	protein domain specific binding
GO:0045296	0.907	cadherin binding
GO:0043167	0.859	ion binding
GO:0051015	0.774	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0051128	0.973	regulation of cellular component organization
GO:0016043	0.953	cellular component organization
GO:0043254	0.859	regulation of protein-containing complex assembly
GO:0032956	0.798	regulation of actin cytoskeleton organization
GO:0048523	0.791	negative regulation of cellular process
GO:1901879	0.788	regulation of protein depolymerization
GO:1902903	0.786	regulation of supramolecular fiber organization
GO:0032271	0.783	regulation of protein polymerization
GO:0051129	0.782	negative regulation of cellular component organization
GO:0030832	0.778	regulation of actin filament length
GO:0008064	0.747	regulation of actin polymerization or depolymerization
GO:0031333	0.744	negative regulation of protein-containing complex assembly
GO:0043242	0.742	negative regulation of protein-containing complex disassembly
GO:0030833	0.715	regulation of actin filament polymerization
GO:0030834	0.713	regulation of actin filament depolymerization
GO:1901880	0.709	negative regulation of protein depolymerization
GO:0032272	0.709	negative regulation of protein polymerization
GO:1902904	0.694	negative regulation of supramolecular fiber organization
GO:0051494	0.693	negative regulation of cytoskeleton organization
GO:0030837	0.663	negative regulation of actin filament polymerization
GO:0050896	0.657	response to stimulus
GO:0030835	0.578	negative regulation of actin filament depolymerization
GO:0051693	0.401	actin filament capping
GO:0051716	0.395	cellular response to stimulus
GO:0048518	0.355	positive regulation of biological process
GO:0006996	0.309	organelle organization
GO:0022607	0.307	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0031982	0.966	vesicle
GO:0005737	0.943	cytoplasm
GO:0005576	0.940	extracellular region
GO:0005829	0.932	cytosol
GO:0005615	0.927	extracellular space
GO:0070062	0.916	extracellular exosome
GO:0043232	0.489	intracellular non-membrane-bounded organelle
GO:0005856	0.385	cytoskeleton
GO:0031410	0.331	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]