StarFunc result for job id P40145

User Input

>input (1251 residues)
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7UCF8	0.834	0.852	0.000	1225	0.809	0.826	B7UCF8.pdb.gz	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
2	AFDB:P40145	1.000	1.000	0.000	1251	1.000	1.000	P40145.pdb.gz	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1
3	AFDB:D2CFN3	0.738	0.776	7.940E-84	1186	0.354	0.374	D2CFN3.pdb.gz	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
4	AFDB:E9QDH0	0.714	0.764	3.211E-83	1165	0.353	0.379	E9QDH0.pdb.gz
5	AFDB:A0A2R8QEV2	0.686	0.746	4.088E-81	1147	0.363	0.396	A0A2R8QEV2.pdb.gz
6	AFDB:P19754	0.675	0.742	6.923E-77	1134	0.346	0.382	P19754.pdb.gz	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
7	AFDB:D1MIA3	0.696	0.777	7.232E-77	1114	0.320	0.359	D1MIA3.pdb.gz	D1MIA3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=ADCY1b PE=2 SV=1
8	AFDB:B3KWA8	0.611	0.822	1.442E-73	919	0.317	0.431	B3KWA8.pdb.gz	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
9	AFDB:Q29450	0.666	0.766	1.442E-73	1078	0.304	0.353	Q29450.pdb.gz	ADCY7_BOVIN Adenylate cyclase type 7 OS=Bos taurus OX=9913 GN=ADCY7 PE=2 SV=1
10	AFDB:F1LQT1	0.660	0.744	4.895E-73	1100	0.293	0.334	F1LQT1.pdb.gz	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
11	PDB:7yziA	0.170	0.517	7.532E-15	378	0.070	0.230	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
12	PDB:6jt0B	0.174	0.361	2.129E-11	576	0.061	0.132	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
13	PDB:7d9rA	0.160	0.382	3.442E-11	502	0.056	0.139	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
14	PDB:6jt0A	0.163	0.361	4.098E-11	542	0.050	0.114	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
15	PDB:7d9tA	0.146	0.343	2.154E-10	512	0.047	0.115	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
16	PDB:1y11A	0.128	0.389	1.016E-7	364	0.054	0.187	1y11A.pdb.gz
17	PDB:4m1mA	0.094	0.097	7.355E-2	1188	0.086	0.091	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
18	PDB:3nogA	0.070	0.082	7.683E-2	1012	0.065	0.080	3nogA.pdb.gz
19	PDB:6d9mA	0.088	0.276	1.479E-1	326	0.030	0.113	6d9mA.pdb.gz	Structure and mechanism of a Hypr GGDEF enzyme that activates cGAMP signaling to control extracellular metal respiration.
20	PDB:2j0wA	0.061	0.150	1.686E-1	447	0.015	0.043	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384P5Q5	767	1261	0.365	0.362	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3KWA8	727	919	0.331	0.450	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
3	B7UCF8	2021	1225	0.809	0.826	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
4	C9JRT8	664	820	0.304	0.463	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
5	D1MIA3	641	1114	0.297	0.334	D1MIA3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=ADCY1b PE=2 SV=1
6	D2CFN3	776	1186	0.365	0.385	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
7	D4A3N4	677	1119	0.310	0.347	D4A3N4_RAT Adenylate cyclase type 1 OS=Rattus norvegicus OX=10116 GN=Adcy1 PE=1 SV=3
8	F1LQT1	578	1100	0.301	0.343	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
9	G0TC75	620	982	0.290	0.370	G0TC75_BOVIN adenylate cyclase OS=Bos taurus OX=9913 GN=ADCY2 PE=2 SV=1
10	O43306	759	1168	0.361	0.387	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
11	O60266	687	1144	0.324	0.354	ADCY3_HUMAN Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3
12	O88444	683	1118	0.313	0.350	ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2
13	O95622	767	1261	0.365	0.362	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
14	O96306	572	1167	0.282	0.302	O96306_DROME adenylate cyclase OS=Drosophila melanogaster OX=7227 GN=Ac3 PE=2 SV=1
15	P19754	689	1134	0.317	0.349	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
16	P21932	689	1144	0.322	0.352	ADCY3_RAT Adenylate cyclase type 3 OS=Rattus norvegicus OX=10116 GN=Adcy3 PE=1 SV=1
17	P26769	661	1090	0.317	0.364	ADCY2_RAT Adenylate cyclase type 2 OS=Rattus norvegicus OX=10116 GN=Adcy2 PE=1 SV=1
18	P26770	581	1064	0.295	0.347	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
19	P30803	769	1265	0.365	0.361	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
20	P40145	2588	1251	1.000	1.000	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	2.8e-31	120.7	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF06327 Adcy_cons_dom	1.7e-27	107.3	Adenylate cyclase, conserved domain
3	PF00211 Guanylate_cyc	1.5e-123	420.8	Adenylate and Guanylate cyclase catalytic domain
4	PF18396 TBK1_ULD	18	16.6	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366488	0.972	cAMP-dependent protein kinase catalytic subunit gamma
2	9606.ENSP00000334051	0.970	Guanine nucleotide-binding protein G(olf) subunit alpha
3	9606.ENSP00000378207	0.965	A-kinase anchor protein 5
4	9606.ENSP00000360141	0.958	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
5	9606.ENSP00000262494	0.953	Guanine nucleotide-binding protein G(o) subunit alpha
6	9606.ENSP00000358867	0.949	Guanine nucleotide-binding protein G(k) subunit alpha
7	9606.ENSP00000294016	0.943	Adenylate cyclase type 9
8	9606.ENSP00000312999	0.943	Guanine nucleotide-binding protein G(i) subunit alpha-2
9	9606.ENSP00000343027	0.942	Guanine nucleotide-binding protein G(i) subunit alpha-1
10	9606.ENSP00000478892	0.942	Guanine nucleotide-binding protein G(z) subunit alpha
11	9606.ENSP00000342952	0.938	Adenylate cyclase type 2
12	9606.ENSP00000378187	0.932	Adenylate cyclase type 7
13	9606.ENSP00000312126	0.931	Adenylate cyclase type 4
14	9606.ENSP00000480616	0.922	Calcium release-activated calcium channel protein 1
15	9606.ENSP00000297323	0.921	Adenylate cyclase type 1
16	9606.ENSP00000419361	0.917	Adenylate cyclase type 5
17	9606.ENSP00000311405	0.910	Adenylate cyclase type 6
18	9606.ENSP00000260600	0.909	Adenylate cyclase type 3
19	9606.ENSP00000306124	0.907	Protein kinase C epsilon type
20	9606.ENSP00000395708	0.906	Rap guanine nucleotide exchange factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0005488	0.920	binding
GO:0008294	0.850	calcium- and calmodulin-responsive adenylate cyclase activity
GO:0005515	0.672	protein binding
GO:0019899	0.477	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.974	response to stimulus
GO:0009987	0.974	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0023052	0.962	signaling
GO:0007154	0.962	cell communication
GO:0051716	0.945	cellular response to stimulus
GO:0042221	0.909	response to chemical
GO:0007188	0.906	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0032501	0.901	multicellular organismal process
GO:0007189	0.852	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0010243	0.802	response to organonitrogen compound
GO:0071704	0.750	organic substance metabolic process
GO:0044238	0.721	primary metabolic process
GO:0044237	0.719	cellular metabolic process
GO:1901701	0.713	cellular response to oxygen-containing compound
GO:0043279	0.699	response to alkaloid
GO:1902074	0.698	response to salt
GO:0061178	0.674	regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0014072	0.659	response to isoquinoline alkaloid
GO:0003008	0.604	system process
GO:0006807	0.569	nitrogen compound metabolic process
GO:0048518	0.488	positive regulation of biological process
GO:0043278	0.472	response to morphine
GO:0050877	0.440	nervous system process
GO:1901564	0.421	organonitrogen compound metabolic process
GO:0009187	0.420	cyclic nucleotide metabolic process
GO:0050890	0.417	cognition
GO:0048522	0.404	positive regulation of cellular process
GO:0019222	0.383	regulation of metabolic process
GO:0007610	0.349	behavior

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.902	intracellular anatomical structure
GO:0043226	0.863	organelle
GO:0043229	0.721	intracellular organelle
GO:0043227	0.530	membrane-bounded organelle
GO:0005737	0.346	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]