StarFunc result for job id P40189

User Input

>input (918 residues)
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40189	1.000	1.000	0.000	918	1.000	1.000	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
2	AFDB:P40190	0.761	0.761	0.000	918	0.785	0.785	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
3	AFDB:Q00560	0.773	0.774	0.000	917	0.769	0.770	Q00560.pdb.gz	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
4	AFDB:Q9W213	0.150	0.107	1.426E-30	1395	0.151	0.100	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
5	AFDB:F1R2D2	0.147	0.091	3.469E-30	1687	0.154	0.084	F1R2D2.pdb.gz
6	AFDB:Q9VPZ7	0.138	0.105	2.029E-28	1342	0.161	0.110	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
7	AFDB:Q4ZHG4	0.140	0.075	5.114E-27	1894	0.106	0.051	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
8	AFDB:Q2Q0I9	0.128	0.072	1.385E-23	1779	0.111	0.057	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
9	AFDB:Q9VFU7	0.158	0.148	2.863E-21	1001	0.132	0.121	Q9VFU7.pdb.gz	Q9VFU7_DROME Sidestep IV, isoform C OS=Drosophila melanogaster OX=7227 GN=side-IV PE=1 SV=3
10	AFDB:A0A2R8QME5	0.131	0.115	1.460E-15	1094	0.127	0.107	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
11	PDB:1e07A	0.151	0.189	6.025E-14	642	0.085	0.121	1e07A.pdb.gz
12	PDB:4ziqA	0.098	0.072	1.433E-11	1450	0.086	0.054	4ziqA.pdb.gz
13	PDB:7q1yA	0.123	0.092	1.502E-11	1374	0.075	0.050	7q1yA.pdb.gz
14	PDB:5oj2B	0.102	0.127	1.989E-11	692	0.082	0.108	5oj2B.pdb.gz
15	PDB:8dtlA	0.139	0.164	7.719E-11	741	0.068	0.084	8dtlA.pdb.gz
16	PDB:6pxvA	0.172	0.191	9.307E-11	823	0.062	0.069	6pxvA.pdb.gz
17	PDB:5a42A	0.109	0.068	2.160E-10	1597	0.072	0.041	5a42A.pdb.gz
18	PDB:7q5zA	0.117	0.089	2.604E-10	1344	0.070	0.048	7q5zA.pdb.gz
19	PDB:4lnvA	0.114	0.088	1.110E-9	1276	0.073	0.053	4lnvA.pdb.gz
20	PDB:6h03A	0.110	0.090	1.219E-9	1223	0.068	0.051	6h03A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40189	0.0	1917	918	1.000	1.000	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
2	P40190	0.0	1441	918	0.786	0.786	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
3	Q00560	0.0	1434	917	0.771	0.772	IL6RB_MOUSE Interleukin-6 receptor subunit beta OS=Mus musculus OX=10090 GN=Il6st PE=1 SV=2
4	Q17RA0	0.0	1913	918	0.998	0.998	Q17RA0_HUMAN Interleukin 6 signal transducer (Gp130, oncostatin M receptor) OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=1
5	F1RCZ2	1.85e-138	436	859	0.329	0.352	F1RCZ2_DANRE Interleukin 6 cytokine family signal transduce OS=Danio rerio OX=7955 GN=gp130 PE=4 SV=2
6	A8WH79	3.03e-129	412	866	0.322	0.342	A8WH79_DANRE Gp130 protein OS=Danio rerio OX=7955 GN=gp130 PE=2 SV=1
7	Q8NI17	7.05e-66	237	732	0.176	0.221	IL31R_HUMAN Interleukin-31 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL31RA PE=1 SV=1
8	Q99062	1.85e-65	238	836	0.242	0.266	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
9	Q8K5B1	2.94e-57	212	716	0.203	0.260	IL31R_MOUSE Interleukin-31 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il31ra PE=1 SV=3
10	F1R904	2.29e-53	202	810	0.237	0.269	F1R904_DANRE Colony-stimulating factor 3 receptor (granulocyte) OS=Danio rerio OX=7955 GN=gcsfr PE=3 SV=1
11	A8Y5W0	2.61e-53	202	810	0.240	0.272	A8Y5W0_DANRE Granulocyte colony-stimulating factor receptor OS=Danio rerio OX=7955 GN=gcsfr PE=2 SV=1
12	P40223	1.68e-51	197	837	0.228	0.250	CSF3R_MOUSE Granulocyte colony-stimulating factor receptor OS=Mus musculus OX=10090 GN=Csf3r PE=1 SV=2
13	D4A3R0	7.64e-45	177	849	0.224	0.243	D4A3R0_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=2
14	P42702	6.82e-43	171	1097	0.185	0.155	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
15	A0A8I6B3M3	1.05e-42	170	877	0.229	0.239	A0A8I6B3M3_RAT Colony stimulating factor 3 receptor OS=Rattus norvegicus OX=10116 GN=Csf3r PE=3 SV=1
16	Q99665	1.57e-38	157	862	0.193	0.205	I12R2_HUMAN Interleukin-12 receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=IL12RB2 PE=1 SV=1
17	P97378	2.57e-37	153	874	0.187	0.197	I12R2_MOUSE Interleukin-12 receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Il12rb2 PE=1 SV=1
18	F1LRH7	2.89e-37	153	869	0.180	0.190	F1LRH7_RAT Interleukin 12 receptor subunit beta 2 OS=Rattus norvegicus OX=10116 GN=Il12rb2 PE=3 SV=2
19	P42703	1.83e-36	151	1092	0.157	0.132	LIFR_MOUSE Leukemia inhibitory factor receptor OS=Mus musculus OX=10090 GN=Lifr PE=1 SV=1
20	O70535	9.74e-35	145	1093	0.162	0.136	LIFR_RAT Leukemia inhibitory factor receptor OS=Rattus norvegicus OX=10116 GN=Lifr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06058 DCP1	3.7e+02	12.4	Dcp1-like decapping family
2	PF09067 EpoR_lig-bind	0.0021	29.6	Erythropoietin receptor, ligand binding
3	PF00041 fn3	2.4e-27	106.4	Fibronectin type III domain
4	PF16893 fn3_2	2.3	19.7	Fibronectin type III domain
5	PF09240 IL6Ra-bind	0.001	30.8	Interleukin-6 receptor alpha chain, binding
6	PF09294 Interfer-bind	5.5	18.7	Interferon-alpha/beta receptor, fibronectin type III
7	PF06328 Lep_receptor_Ig	6.4e-26	101.5	Ig-like C2-type domain
8	PF18589 ObR_Ig	7.7e+02	11.9	Obesity receptor immunoglobulin like domain
9	PF16656 Pur_ac_phosph_N	2.4	20.2	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385675	0.999	Interleukin-6
2	9606.ENSP00000343204	0.998	Tyrosine-protein kinase JAK1
3	9606.ENSP00000249075	0.997	Leukemia inhibitory factor
4	9606.ENSP00000340944	0.997	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000357470	0.994	Interleukin-6 receptor subunit alpha
6	9606.ENSP00000330341	0.993	Suppressor of cytokine signaling 3
7	9606.ENSP00000215781	0.990	Oncostatin-M
8	9606.ENSP00000371067	0.989	Tyrosine-protein kinase JAK2
9	9606.ENSP00000264657	0.986	Signal transducer and activator of transcription 3
10	9606.ENSP00000354394	0.985	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000355370	0.985	Ciliary neurotrophic factor
12	9606.ENSP00000349365	0.963	Interleukin-27 subunit alpha
13	9606.ENSP00000264563	0.961	Interleukin-11
14	9606.ENSP00000274276	0.956	Oncostatin-M-specific receptor subunit beta
15	9606.ENSP00000431885	0.953	Non-receptor tyrosine-protein kinase TYK2
16	9606.ENSP00000450565	0.949	Interleukin-11 receptor subunit alpha
17	9606.ENSP00000263409	0.941	Leukemia inhibitory factor receptor
18	9606.ENSP00000376134	0.941	Signal transducer and activator of transcription 4
19	9606.ENSP00000444986	0.940	Tyrosine-protein kinase HCK
20	9606.ENSP00000263379	0.932	Interleukin-27 receptor subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0019838	1.000	growth factor binding
GO:0004896	1.000	cytokine receptor activity
GO:0005126	0.995	cytokine receptor binding
GO:0042802	0.970	identical protein binding
GO:0070851	0.879	growth factor receptor binding
GO:0097110	0.840	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0048522	0.985	positive regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:0023052	0.975	signaling
GO:0007154	0.975	cell communication
GO:0042221	0.965	response to chemical
GO:0007165	0.960	signal transduction
GO:0042127	0.958	regulation of cell population proliferation
GO:0019221	0.948	cytokine-mediated signaling pathway
GO:0008284	0.945	positive regulation of cell population proliferation
GO:0048583	0.926	regulation of response to stimulus
GO:0045597	0.916	positive regulation of cell differentiation
GO:0048856	0.915	anatomical structure development
GO:0071354	0.909	cellular response to interleukin-6
GO:0048584	0.888	positive regulation of response to stimulus
GO:0023051	0.884	regulation of signaling
GO:0010646	0.883	regulation of cell communication
GO:0050730	0.881	regulation of peptidyl-tyrosine phosphorylation
GO:0022407	0.879	regulation of cell-cell adhesion
GO:0045785	0.879	positive regulation of cell adhesion
GO:0002694	0.877	regulation of leukocyte activation
GO:0050870	0.866	positive regulation of T cell activation
GO:0009966	0.862	regulation of signal transduction
GO:0050731	0.855	positive regulation of peptidyl-tyrosine phosphorylation
GO:0070665	0.845	positive regulation of leukocyte proliferation
GO:0050670	0.844	regulation of lymphocyte proliferation
GO:0042531	0.837	positive regulation of tyrosine phosphorylation of STAT protein
GO:0009967	0.835	positive regulation of signal transduction
GO:0007167	0.830	enzyme-linked receptor protein signaling pathway
GO:0032103	0.823	positive regulation of response to external stimulus
GO:0032501	0.798	multicellular organismal process
GO:0032946	0.778	positive regulation of mononuclear cell proliferation
GO:0050671	0.772	positive regulation of lymphocyte proliferation
GO:0042102	0.757	positive regulation of T cell proliferation
GO:0010468	0.715	regulation of gene expression
GO:0031347	0.705	regulation of defense response
GO:0048519	0.685	negative regulation of biological process
GO:0050727	0.650	regulation of inflammatory response
GO:0010941	0.530	regulation of cell death
GO:0008152	0.506	metabolic process
GO:0001819	0.493	positive regulation of cytokine production
GO:0048523	0.490	negative regulation of cellular process
GO:0030154	0.479	cell differentiation
GO:0009888	0.439	tissue development
GO:0071704	0.432	organic substance metabolic process
GO:0007275	0.413	multicellular organism development
GO:0019219	0.381	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.367	primary metabolic process
GO:0044237	0.350	cellular metabolic process
GO:0042981	0.347	regulation of apoptotic process
GO:0009605	0.344	response to external stimulus
GO:0048731	0.327	system development
GO:0031326	0.326	regulation of cellular biosynthetic process
GO:0010556	0.316	regulation of macromolecule biosynthetic process
GO:0006950	0.300	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.976	membrane-bounded organelle
GO:0005576	0.971	extracellular region
GO:0032991	0.951	protein-containing complex
GO:0031982	0.827	vesicle
GO:0005615	0.810	extracellular space
GO:0005622	0.705	intracellular anatomical structure
GO:0043231	0.618	intracellular membrane-bounded organelle
GO:0005737	0.562	cytoplasm
GO:0012505	0.409	endomembrane system
GO:0043235	0.326	receptor complex
GO:0070062	0.320	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]