StarFunc result for job id P40205

User Input

>input (109 residues)
MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGR
LLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40205	1.000	1.000	7.894E-15	109	1.000	1.000	P40205.pdb.gz	NCYM_HUMAN N-cym protein OS=Homo sapiens OX=9606 GN=MYCNOS PE=1 SV=2
2	AFDB:O42913	0.263	0.097	7.125	342	0.174	0.056	O42913.pdb.gz	NRM1_SCHPO Transcription factor nrm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrm1 PE=1 SV=1
3	AFDB:Q0VAL7	0.236	0.177	7.125	162	0.138	0.093	Q0VAL7.pdb.gz	Q0VAL7_HUMAN C21orf58 protein OS=Homo sapiens OX=9606 GN=C21orf58 PE=1 SV=1
4	AFDB:Q9VBN2	0.226	0.033	7.628	1028	0.174	0.018	Q9VBN2.pdb.gz	Q9VBN2_DROME Lipophorin receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=4
5	AFDB:O94682	0.179	0.093	8.166	253	0.119	0.051	O94682.pdb.gz	MIS20_SCHPO CENP-A recruiting complex protein mis20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis20 PE=1 SV=1
6	AFDB:Q5BJH7	0.260	0.094	8.166	314	0.110	0.038	Q5BJH7.pdb.gz	YIF1B_HUMAN Protein YIF1B OS=Homo sapiens OX=9606 GN=YIF1B PE=1 SV=1
7	AFDB:Q7KNF2	0.248	0.132	8.742	224	0.128	0.062	Q7KNF2.pdb.gz	PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Pabp2 PE=1 SV=1
8	AFDB:G5EDT2	0.260	0.091	9.359	366	0.092	0.027	G5EDT2.pdb.gz	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1
9	AFDB:P36115	0.162	0.050	9.359	615	0.156	0.028	P36115.pdb.gz	IRS4_YEAST Increased rDNA silencing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRS4 PE=1 SV=1
10	AFDB:Q9USP7	0.284	0.089	9.359	397	0.138	0.038	Q9USP7.pdb.gz	YHP6_SCHPO Uncharacterized protein C902.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC902.06 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40205	2.60e-75	219	109	1.000	1.000	NCYM_HUMAN N-cym protein OS=Homo sapiens OX=9606 GN=MYCNOS PE=1 SV=2
2	Q6AXR4	0.13	33.1	537	0.239	0.048	HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1
3	Q00IB6	0.24	32.3	440	0.202	0.050	CPL4_ARATH RNA polymerase II C-terminal domain phosphatase-like 4 OS=Arabidopsis thaliana OX=3702 GN=CPL4 PE=1 SV=1
4	P20060	1.1	30.4	536	0.239	0.049	HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2
5	Q9CQ79	2.4	29.3	226	0.128	0.062	TXND9_MOUSE Thioredoxin domain-containing protein 9 OS=Mus musculus OX=10090 GN=Txndc9 PE=1 SV=1
6	B8ZZX4	3.0	28.9	135	0.128	0.104	B8ZZX4_HUMAN Thioredoxin domain containing 9 (Fragment) OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=1
7	O14530	4.2	28.5	226	0.128	0.062	TXND9_HUMAN Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2
8	A2BHD8	5.5	28.5	541	0.220	0.044	A2BHD8_DANRE Beta-hexosaminidase OS=Danio rerio OX=7955 GN=fc04h11 PE=1 SV=1
9	Q0DVX2	7.1	28.1	641	0.156	0.027	RH50_ORYSJ DEAD-box ATP-dependent RNA helicase 50 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0108600 PE=2 SV=2
10	J3KNP2	9.7	27.7	697	0.239	0.037	J3KNP2_HUMAN Transducin beta like 3 (Fragment) OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 929712.KI912613_gene2894

Rank	PPI partner	STRING score	Description
1	929712.KI912613_gene3042	0.999	annotation not available
2	929712.KI912613_gene4926	0.999	annotation not available
3	929712.KI912613_gene4963	0.999	annotation not available
4	929712.KI912613_gene1117	0.966	annotation not available
5	929712.KI912613_gene4192	0.956	annotation not available
6	929712.KI912613_gene4198	0.952	annotation not available
7	929712.KI912613_gene3518	0.944	annotation not available
8	929712.KI912613_gene4294	0.912	annotation not available
9	929712.KI912613_gene2896	0.907	annotation not available
10	929712.KI912613_gene2824	0.887	annotation not available
11	929712.KI912613_gene5001	0.884	annotation not available
12	929712.KI912613_gene3602	0.857	annotation not available
13	929712.KI912613_gene4941	0.849	annotation not available
14	929712.KI912613_gene4187	0.846	annotation not available
15	929712.KI912613_gene4921	0.845	annotation not available
16	929712.KI912613_gene1126	0.844	annotation not available
17	929712.KI912613_gene4955	0.837	annotation not available
18	929712.KI912613_gene4930	0.835	annotation not available
19	929712.KI912613_gene1125	0.831	annotation not available
20	929712.KI912613_gene2895	0.831	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031647	0.786	regulation of protein stability
GO:0051174	0.759	regulation of phosphorus metabolic process
GO:0051338	0.753	regulation of transferase activity
GO:0031324	0.707	negative regulation of cellular metabolic process
GO:0010563	0.696	negative regulation of phosphorus metabolic process
GO:0042326	0.681	negative regulation of phosphorylation
GO:0044092	0.671	negative regulation of molecular function
GO:0043549	0.664	regulation of kinase activity
GO:0033673	0.647	negative regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]