StarFunc result for job id P40225

User Input

>input (353 residues)
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV
LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT
AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL
DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40225	1.000	1.000	5.399E-48	353	1.000	1.000	P40225.pdb.gz	TPO_HUMAN Thrombopoietin OS=Homo sapiens OX=9606 GN=THPO PE=1 SV=1
2	AFDB:P49745	0.475	0.513	2.529E-34	326	0.694	0.752	P49745.pdb.gz	TPO_RAT Thrombopoietin OS=Rattus norvegicus OX=10116 GN=Thpo PE=2 SV=1
3	AFDB:P40226	0.458	0.455	7.080E-34	356	0.720	0.713	P40226.pdb.gz	TPO_MOUSE Thrombopoietin OS=Mus musculus OX=10090 GN=Thpo PE=2 SV=1
4	PDB:1buyA	0.358	0.708	4.045E-6	166	0.096	0.205	1buyA.pdb.gz
5	AFDB:Q8JZQ0	0.268	0.182	8.112E-3	566	0.167	0.104	Q8JZQ0.pdb.gz	CSF1_RAT Macrophage colony-stimulating factor 1 OS=Rattus norvegicus OX=10116 GN=Csf1 PE=1 SV=1
6	PDB:7u7nD	0.297	0.507	1.044E-2	191	0.085	0.157	7u7nD.pdb.gz
7	PDB:6o4oA	0.230	0.416	3.832E-2	169	0.102	0.213	6o4oA.pdb.gz
8	PDB:1bp3A	0.184	0.314	4.045E-2	186	0.071	0.134	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
9	PDB:7zxkC	0.271	0.531	4.270E-2	166	0.079	0.169	7zxkC.pdb.gz
10	AFDB:Q500P4	0.120	0.125	7.084E-2	338	0.127	0.133	Q500P4.pdb.gz	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
11	PDB:7z0lB	0.288	0.276	7.750E-2	370	0.082	0.078	7z0lB.pdb.gz
12	PDB:1f6fA	0.229	0.395	2.169E-1	183	0.059	0.115	1f6fA.pdb.gz
13	PDB:1huwA	0.189	0.341	3.170E-1	166	0.091	0.193	1huwA.pdb.gz
14	AFDB:D3ZFJ3	0.143	0.090	3.409E-1	689	0.139	0.071	D3ZFJ3.pdb.gz	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1
15	PDB:1cnt1	0.247	0.479	3.533E-1	150	0.074	0.173	1cnt1.pdb.gz
16	PDB:1rhgB	0.168	0.312	3.533E-1	144	0.059	0.146	1rhgB.pdb.gz
17	AFDB:Q9P6S3	0.106	0.041	4.470E-1	1052	0.110	0.037	Q9P6S3.pdb.gz	UDS1_SCHPO Up-regulated during septation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uds1 PE=1 SV=1
18	AFDB:A0A0R4IN23	0.121	0.030	6.187E-1	2018	0.136	0.024	A0A0R4IN23.pdb.gz
19	AFDB:Q9VYV4	0.100	0.068	8.564E-1	550	0.144	0.093	Q9VYV4.pdb.gz	Q9VYV4_DROME Amun, isoform A OS=Drosophila melanogaster OX=7227 GN=Amun PE=1 SV=1
20	AFDB:P59017	0.088	0.071	9.040E-1	434	0.130	0.106	P59017.pdb.gz	B2L13_MOUSE Bcl-2-like protein 13 OS=Mus musculus OX=10090 GN=Bcl2l13 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40225	0.0	688	353	1.000	1.000	TPO_HUMAN Thrombopoietin OS=Homo sapiens OX=9606 GN=THPO PE=1 SV=1
2	P40226	8.64e-142	407	356	0.686	0.680	TPO_MOUSE Thrombopoietin OS=Mus musculus OX=10090 GN=Thpo PE=2 SV=1
3	P49745	5.03e-139	399	326	0.663	0.718	TPO_RAT Thrombopoietin OS=Rattus norvegicus OX=10116 GN=Thpo PE=2 SV=1
4	Q2XNF5	1.35e-06	50.4	183	0.127	0.246	EPO_DANRE Erythropoietin OS=Danio rerio OX=7955 GN=epo PE=1 SV=1
5	P42706	2.77e-06	45.4	26	0.059	0.808	TPO_PIG Thrombopoietin (Fragment) OS=Sus scrofa OX=9823 GN=THPO PE=1 SV=1
6	Q17R89	0.009	40.4	818	0.093	0.040	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
7	P29676	0.050	37.0	192	0.113	0.208	EPO_RAT Erythropoietin OS=Rattus norvegicus OX=10116 GN=Epo PE=2 SV=1
8	P07321	0.12	35.8	192	0.108	0.198	EPO_MOUSE Erythropoietin OS=Mus musculus OX=10090 GN=Epo PE=2 SV=1
9	P01588	0.59	33.9	193	0.116	0.212	EPO_HUMAN Erythropoietin OS=Homo sapiens OX=9606 GN=EPO PE=1 SV=1
10	B5L331	2.5	32.0	191	0.074	0.136	B5L331_DANRE Thrombopoietin OS=Danio rerio OX=7955 GN=Tpo PE=2 SV=1
11	F4JJ27	3.7	32.3	1352	0.040	0.010	F4JJ27_ARATH Peroxisomal ABC transporter 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=1 SV=1
12	P53168	3.8	31.6	247	0.062	0.089	DUO1_YEAST DASH complex subunit DUO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DUO1 PE=1 SV=1
13	Q94FB9	3.9	32.0	1337	0.040	0.010	AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCD1 PE=1 SV=1
14	M9PC48	4.7	32.0	18095	0.051	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PCJ6	4.7	32.0	18641	0.051	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	A6H8Y1	6.9	31.2	2624	0.065	0.009	BDP1_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1 PE=1 SV=3
17	O54714	8.0	30.8	628	0.105	0.059	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
18	P16112	8.8	31.2	2530	0.079	0.011	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15153 CYTL1	91	14.4	Cytokine-like protein 1
2	PF00758 EPO_TPO	9.1e-44	160.9	Erythropoietin/thrombopoietin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000204615

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361548	0.999	Thrombopoietin receptor
2	9606.ENSP00000252723	0.979	Erythropoietin
3	9606.ENSP00000371067	0.967	Tyrosine-protein kinase JAK2
4	9606.ENSP00000225474	0.966	Granulocyte colony-stimulating factor
5	9606.ENSP00000293328	0.958	Signal transducer and activator of transcription 5B
6	9606.ENSP00000341208	0.958	Signal transducer and activator of transcription 5A
7	9606.ENSP00000228280	0.957	Kit ligand
8	9606.ENSP00000264657	0.943	Signal transducer and activator of transcription 3
9	9606.ENSP00000296870	0.934	Interleukin-3
10	9606.ENSP00000401303	0.934	SHC-transforming protein 1
11	9606.ENSP00000354394	0.929	Signal transducer and activator of transcription 1-alpha/beta
12	9606.ENSP00000376345	0.919	Growth factor receptor-bound protein 2
13	9606.ENSP00000428056	0.910	Phosphatidylinositol 3-kinase regulatory subunit alpha
14	9606.ENSP00000263967	0.905	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
15	9606.ENSP00000244007	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
16	9606.ENSP00000387784	0.900	Son of sevenless homolog 1
17	9606.ENSP00000302150	0.898	Prolactin
18	9606.ENSP00000222139	0.878	Erythropoietin receptor
19	9606.ENSP00000312652	0.861	Leptin
20	9606.ENSP00000310036	0.854	Hematopoietic progenitor cell antigen CD34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.997	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0007166	0.993	cell surface receptor signaling pathway
GO:0048518	0.987	positive regulation of biological process
GO:0048522	0.980	positive regulation of cellular process
GO:0009966	0.980	regulation of signal transduction
GO:0071345	0.980	cellular response to cytokine stimulus
GO:0042127	0.966	regulation of cell population proliferation
GO:0009967	0.946	positive regulation of signal transduction
GO:0048856	0.932	anatomical structure development
GO:0008284	0.920	positive regulation of cell population proliferation
GO:1902531	0.905	regulation of intracellular signal transduction
GO:1902533	0.902	positive regulation of intracellular signal transduction
GO:0032501	0.901	multicellular organismal process
GO:0030154	0.854	cell differentiation
GO:0019221	0.850	cytokine-mediated signaling pathway
GO:0019222	0.810	regulation of metabolic process
GO:0048468	0.792	cell development
GO:0009893	0.679	positive regulation of metabolic process
GO:0060255	0.674	regulation of macromolecule metabolic process
GO:0031323	0.672	regulation of cellular metabolic process
GO:1990868	0.640	response to chemokine
GO:0007275	0.638	multicellular organism development
GO:0010604	0.603	positive regulation of macromolecule metabolic process
GO:0080090	0.566	regulation of primary metabolic process
GO:0051171	0.565	regulation of nitrogen compound metabolic process
GO:0048731	0.537	system development
GO:0043410	0.512	positive regulation of MAPK cascade
GO:0051239	0.511	regulation of multicellular organismal process
GO:0030097	0.474	hemopoiesis
GO:0051174	0.435	regulation of phosphorus metabolic process
GO:0019220	0.433	regulation of phosphate metabolic process
GO:0031325	0.425	positive regulation of cellular metabolic process
GO:0097696	0.417	receptor signaling pathway via STAT
GO:0050793	0.410	regulation of developmental process
GO:0002682	0.405	regulation of immune system process
GO:0051173	0.401	positive regulation of nitrogen compound metabolic process
GO:0030099	0.397	myeloid cell differentiation
GO:0051246	0.395	regulation of protein metabolic process
GO:0042327	0.395	positive regulation of phosphorylation
GO:0051897	0.362	positive regulation of protein kinase B signaling
GO:0031401	0.359	positive regulation of protein modification process
GO:0001934	0.348	positive regulation of protein phosphorylation
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005622	0.891	intracellular anatomical structure
GO:0043226	0.889	organelle
GO:0043229	0.762	intracellular organelle
GO:0043227	0.710	membrane-bounded organelle
GO:0070013	0.707	intracellular organelle lumen
GO:0005737	0.698	cytoplasm
GO:0043231	0.677	intracellular membrane-bounded organelle
GO:0031981	0.417	nuclear lumen
GO:0005886	0.407	plasma membrane
GO:0005615	0.339	extracellular space
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]