StarFunc result for job id P40238

User Input

>input (635 residues)
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40238	1.000	1.000	0.000	635	1.000	1.000	P40238.pdb.gz	TPOR_HUMAN Thrombopoietin receptor OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=1
2	AFDB:A0A1W2Q6N1	0.739	0.729	3.053E-93	644	0.805	0.793	A0A1W2Q6N1.pdb.gz	A0A1W2Q6N1_RAT MPL proto-oncogene, thrombopoietin receptor OS=Rattus norvegicus OX=10116 GN=Mpl PE=3 SV=1
3	AFDB:A0A2R8PZ02	0.384	0.375	8.248E-36	655	0.214	0.208	A0A2R8PZ02.pdb.gz
4	AFDB:Q04594	0.255	0.203	4.560E-25	831	0.191	0.146	Q04594.pdb.gz	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
5	AFDB:G3V608	0.174	0.128	2.383E-22	895	0.175	0.124	G3V608.pdb.gz	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
6	AFDB:D3ZDS9	0.256	0.269	6.831E-20	593	0.121	0.130	D3ZDS9.pdb.gz	D3ZDS9_RAT Interferon alpha and beta receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Ifnar1 PE=4 SV=2
7	AFDB:H0ZIF9	0.247	0.147	3.941E-19	1135	0.153	0.085	H0ZIF9.pdb.gz	H0ZIF9_TAEGU Leptin receptor OS=Taeniopygia guttata OX=59729 GN=LEPR PE=2 SV=2
8	AFDB:P48357	0.248	0.145	4.356E-19	1165	0.151	0.082	P48357.pdb.gz	LEPR_HUMAN Leptin receptor OS=Homo sapiens OX=9606 GN=LEPR PE=1 SV=2
9	AFDB:P42702	0.260	0.160	5.322E-19	1097	0.139	0.080	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
10	AFDB:Q99062	0.245	0.191	7.556E-19	836	0.183	0.139	Q99062.pdb.gz	CSF3R_HUMAN Granulocyte colony-stimulating factor receptor OS=Homo sapiens OX=9606 GN=CSF3R PE=1 SV=1
11	PDB:6pxvA	0.136	0.108	1.577E-9	823	0.080	0.062	6pxvA.pdb.gz
12	PDB:8eyyA	0.147	0.125	1.577E-9	775	0.087	0.071	8eyyA.pdb.gz
13	PDB:7u7nC	0.226	0.604	4.989E-9	200	0.071	0.225	7u7nC.pdb.gz
14	PDB:8dtlA	0.133	0.117	7.448E-9	741	0.071	0.061	8dtlA.pdb.gz
15	PDB:6pyhD	0.141	0.118	1.169E-8	798	0.072	0.058	6pyhD.pdb.gz
16	PDB:5mj3A	0.219	0.406	2.132E-8	302	0.065	0.136	5mj3A.pdb.gz
17	PDB:1e07A	0.200	0.198	2.356E-8	642	0.080	0.079	1e07A.pdb.gz
18	PDB:7z0lB	0.223	0.359	2.606E-7	370	0.074	0.127	7z0lB.pdb.gz
19	PDB:2rcjC	0.132	0.154	1.113E-6	523	0.083	0.101	2rcjC.pdb.gz
20	PDB:5oj2B	0.137	0.128	2.030E-6	692	0.077	0.071	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2Q670	0.0	666	460	0.524	0.724	A0A1W2Q670_RAT MPL proto-oncogene, thrombopoietin receptor OS=Rattus norvegicus OX=10116 GN=Mpl PE=4 SV=2
2	A0A1W2Q6N1	0.0	984	644	0.806	0.795	A0A1W2Q6N1_RAT MPL proto-oncogene, thrombopoietin receptor OS=Rattus norvegicus OX=10116 GN=Mpl PE=3 SV=1
3	P40238	0.0	1296	635	1.000	1.000	TPOR_HUMAN Thrombopoietin receptor OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=1
4	Q08351	0.0	986	625	0.806	0.819	TPOR_MOUSE Thrombopoietin receptor OS=Mus musculus OX=10090 GN=Mpl PE=2 SV=2
5	Q5JUY5	0.0	1276	628	0.989	1.000	Q5JUY5_HUMAN MPL proto-oncogene, thrombopoietin receptor OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=2
6	Q1ERS7	7.53e-132	388	240	0.328	0.867	Q1ERS7_RAT Myeloproliferative leukemia virus oncogene (Fragment) OS=Rattus norvegicus OX=10116 GN=Mpl PE=2 SV=1
7	A0A2R8YE13	3.81e-79	250	177	0.209	0.751	A0A2R8YE13_HUMAN MPL proto-oncogene, thrombopoietin receptor (Fragment) OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=1
8	Q6EIY6	4.27e-38	151	614	0.205	0.212	Q6EIY6_DANRE Myeloproliferative leukemia virus oncogene, like OS=Danio rerio OX=7955 GN=mpll PE=2 SV=1
9	Q2VBQ8	7.92e-15	79.7	509	0.110	0.138	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
10	P19235	1.98e-08	59.7	508	0.113	0.142	EPOR_HUMAN Erythropoietin receptor OS=Homo sapiens OX=9606 GN=EPOR PE=1 SV=1
11	P14753	6.32e-08	57.8	507	0.082	0.103	EPOR_MOUSE Erythropoietin receptor OS=Mus musculus OX=10090 GN=Epor PE=1 SV=1
12	Q07303	1.10e-07	57.0	507	0.087	0.108	EPOR_RAT Erythropoietin receptor OS=Rattus norvegicus OX=10116 GN=Epor PE=2 SV=1
13	Q9JM58	2.09e-06	52.8	425	0.096	0.144	CRLF1_MOUSE Cytokine receptor-like factor 1 OS=Mus musculus OX=10090 GN=Crlf1 PE=1 SV=1
14	O75462	3.41e-06	52.4	422	0.094	0.142	CRLF1_HUMAN Cytokine receptor-like factor 1 OS=Homo sapiens OX=9606 GN=CRLF1 PE=1 SV=1
15	Q4W815	1.03e-05	50.8	525	0.076	0.091	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1
16	Q04594	5.48e-05	48.9	831	0.106	0.081	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
17	Q90374	1.16e-04	47.8	830	0.096	0.073	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
18	P16872	1.71e-04	47.0	459	0.046	0.063	IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il7r PE=1 SV=2
19	A8WH93	1.85e-04	46.6	362	0.102	0.180	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
20	G3V608	6.57e-04	45.4	896	0.107	0.076	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	4.4e-31	118.5	Erythropoietin receptor, ligand binding
2	PF00041 fn3	4.3e-09	47.9	Fibronectin type III domain
3	PF09240 IL6Ra-bind	5.7e-05	34.8	Interleukin-6 receptor alpha chain, binding
4	PF18207 LIFR_N	0.041	25.5	Leukemia inhibitory factor receptor N-terminal domain
5	PF19536 POU2F1_C	3.2e+02	12.2	POU domain, class 2, transcription factor 1 C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361548

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000204615	0.999	Thrombopoietin
2	9606.ENSP00000371067	0.998	Tyrosine-protein kinase JAK2
3	9606.ENSP00000320866	0.985	Calreticulin
4	9606.ENSP00000401303	0.983	SHC-transforming protein 1
5	9606.ENSP00000293328	0.967	Signal transducer and activator of transcription 5B
6	9606.ENSP00000341208	0.960	Signal transducer and activator of transcription 5A
7	9606.ENSP00000264657	0.954	Signal transducer and activator of transcription 3
8	9606.ENSP00000252723	0.942	Erythropoietin
9	9606.ENSP00000296870	0.934	Interleukin-3
10	9606.ENSP00000354394	0.929	Signal transducer and activator of transcription 1-alpha/beta
11	9606.ENSP00000376345	0.924	Growth factor receptor-bound protein 2
12	9606.ENSP00000263967	0.922	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
13	9606.ENSP00000387784	0.908	Son of sevenless homolog 1
14	9606.ENSP00000428056	0.904	Phosphatidylinositol 3-kinase regulatory subunit alpha
15	9606.ENSP00000244007	0.901	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
16	9606.ENSP00000431885	0.827	Non-receptor tyrosine-protein kinase TYK2
17	9606.ENSP00000262407	0.816	Integrin alpha-IIb
18	9606.ENSP00000225474	0.803	Granulocyte colony-stimulating factor
19	9606.ENSP00000343204	0.801	Tyrosine-protein kinase JAK1
20	9606.ENSP00000264563	0.792	Interleukin-11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0038164	0.918	thrombopoietin receptor activity
GO:0005102	0.344	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.992	positive regulation of biological process
GO:0051716	0.991	cellular response to stimulus
GO:0032501	0.988	multicellular organismal process
GO:0048522	0.983	positive regulation of cellular process
GO:0048872	0.961	homeostasis of number of cells
GO:0042221	0.946	response to chemical
GO:0070887	0.929	cellular response to chemical stimulus
GO:0002682	0.926	regulation of immune system process
GO:0051240	0.905	positive regulation of multicellular organismal process
GO:0001776	0.905	leukocyte homeostasis
GO:0002262	0.903	myeloid cell homeostasis
GO:0050865	0.902	regulation of cell activation
GO:1903706	0.902	regulation of hemopoiesis
GO:0006950	0.892	response to stress
GO:0008284	0.884	positive regulation of cell population proliferation
GO:0002684	0.862	positive regulation of immune system process
GO:0045637	0.858	regulation of myeloid cell differentiation
GO:0051094	0.842	positive regulation of developmental process
GO:0051249	0.835	regulation of lymphocyte activation
GO:0023052	0.833	signaling
GO:0007154	0.833	cell communication
GO:0051251	0.832	positive regulation of lymphocyte activation
GO:0001775	0.830	cell activation
GO:0065008	0.829	regulation of biological quality
GO:0070663	0.826	regulation of leukocyte proliferation
GO:0019222	0.825	regulation of metabolic process
GO:0007165	0.816	signal transduction
GO:0045597	0.783	positive regulation of cell differentiation
GO:0070482	0.781	response to oxygen levels
GO:0070665	0.776	positive regulation of leukocyte proliferation
GO:0060255	0.774	regulation of macromolecule metabolic process
GO:0042060	0.767	wound healing
GO:0007599	0.767	hemostasis
GO:0007596	0.739	blood coagulation
GO:0071310	0.737	cellular response to organic substance
GO:0045639	0.731	positive regulation of myeloid cell differentiation
GO:0050671	0.722	positive regulation of lymphocyte proliferation
GO:0030168	0.714	platelet activation
GO:0022603	0.663	regulation of anatomical structure morphogenesis
GO:0007155	0.650	cell adhesion
GO:0048856	0.645	anatomical structure development
GO:0048519	0.626	negative regulation of biological process
GO:0034109	0.617	homotypic cell-cell adhesion
GO:0070527	0.614	platelet aggregation
GO:0001780	0.596	neutrophil homeostasis
GO:0010468	0.591	regulation of gene expression
GO:0009893	0.590	positive regulation of metabolic process
GO:0010770	0.568	positive regulation of cell morphogenesis involved in differentiation
GO:0007166	0.557	cell surface receptor signaling pathway
GO:0071456	0.541	cellular response to hypoxia
GO:0010604	0.539	positive regulation of macromolecule metabolic process
GO:0071345	0.537	cellular response to cytokine stimulus
GO:0048523	0.482	negative regulation of cellular process
GO:0031323	0.465	regulation of cellular metabolic process
GO:0030154	0.340	cell differentiation
GO:0019221	0.334	cytokine-mediated signaling pathway
GO:0030097	0.307	hemopoiesis
GO:0048583	0.305	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.989	endomembrane system
GO:0005622	0.984	intracellular anatomical structure
GO:0005634	0.972	nucleus
GO:0031090	0.806	organelle membrane
GO:0009986	0.745	cell surface
GO:0005737	0.727	cytoplasm
GO:0031975	0.521	envelope
GO:0031967	0.506	organelle envelope
GO:0005635	0.390	nuclear envelope
GO:0031965	0.321	nuclear membrane
GO:0070013	0.316	intracellular organelle lumen
GO:0031982	0.300	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]