StarFunc result for job id P40259

User Input

>input (229 residues)
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40259	1.000	1.000	1.816E-42	229	1.000	1.000	P40259.pdb.gz	CD79B_HUMAN B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens OX=9606 GN=CD79B PE=1 SV=1
2	AFDB:P15530	0.591	0.594	1.352E-29	228	0.690	0.693	P15530.pdb.gz	CD79B_MOUSE B-cell antigen receptor complex-associated protein beta chain OS=Mus musculus OX=10090 GN=Cd79b PE=1 SV=1
3	AFDB:O70153	0.617	0.620	7.464E-29	228	0.694	0.697	O70153.pdb.gz	O70153_RAT B29/Ig-beta/CD79b OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
4	AFDB:Q15116	0.400	0.326	4.044E-11	288	0.183	0.146	Q15116.pdb.gz	PDCD1_HUMAN Programmed cell death protein 1 OS=Homo sapiens OX=9606 GN=PDCD1 PE=1 SV=3
5	AFDB:O14931	0.372	0.419	7.290E-11	201	0.188	0.214	O14931.pdb.gz	NCTR3_HUMAN Natural cytotoxicity triggering receptor 3 OS=Homo sapiens OX=9606 GN=NCR3 PE=1 SV=1
6	AFDB:P50283	0.389	0.421	7.290E-11	210	0.157	0.171	P50283.pdb.gz	CD7_MOUSE T-cell antigen CD7 OS=Mus musculus OX=10090 GN=Cd7 PE=1 SV=1
7	AFDB:P06907	0.352	0.328	3.578E-10	248	0.210	0.194	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
8	AFDB:Q96BF3	0.377	0.314	6.841E-10	282	0.148	0.121	Q96BF3.pdb.gz	TMIG2_HUMAN Transmembrane and immunoglobulin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMIGD2 PE=1 SV=2
9	PDB:4d3cL	0.399	0.434	9.041E-10	209	0.122	0.134	4d3cL.pdb.gz
10	PDB:1k4dB	0.391	0.421	9.589E-10	212	0.105	0.113	1k4dB.pdb.gz
11	AFDB:D3ZIN8	0.392	0.316	9.743E-10	287	0.188	0.150	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
12	PDB:1ct8A	0.383	0.409	1.017E-9	214	0.122	0.131	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
13	AFDB:Q02242	0.398	0.323	1.033E-9	288	0.183	0.146	Q02242.pdb.gz	PDCD1_MOUSE Programmed cell death protein 1 OS=Mus musculus OX=10090 GN=Pdcd1 PE=1 SV=1
14	PDB:4m62L	0.386	0.748	1.214E-9	113	0.109	0.221	4m62L.pdb.gz
15	PDB:1aifA	0.390	0.414	1.287E-9	215	0.131	0.140	1aifA.pdb.gz
16	PDB:6sm1A	0.390	0.767	1.729E-9	111	0.118	0.243	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
17	PDB:1cd0A	0.383	0.758	1.945E-9	111	0.135	0.279	1cd0A.pdb.gz
18	PDB:4aizA	0.382	0.773	2.938E-9	107	0.118	0.252	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
19	PDB:5c6wJ	0.393	0.379	3.116E-9	238	0.127	0.122	5c6wJ.pdb.gz
20	PDB:1otsD	0.393	0.425	4.437E-9	211	0.122	0.133	1otsD.pdb.gz	Gating the Selectivity Filter in ClC Chloride Channels

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40259	7.20e-175	481	229	1.000	1.000	CD79B_HUMAN B-cell antigen receptor complex-associated protein beta chain OS=Homo sapiens OX=9606 GN=CD79B PE=1 SV=1
2	O70153	1.18e-108	313	228	0.699	0.702	O70153_RAT B29/Ig-beta/CD79b OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
3	A0A8J8XPU7	4.19e-108	314	287	0.699	0.557	A0A8J8XPU7_RAT CD79b molecule OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
4	P15530	1.30e-91	270	228	0.686	0.689	CD79B_MOUSE B-cell antigen receptor complex-associated protein beta chain OS=Mus musculus OX=10090 GN=Cd79b PE=1 SV=1
5	A0A8I5Y5U3	2.99e-71	220	264	0.511	0.443	A0A8I5Y5U3_RAT CD79b molecule OS=Rattus norvegicus OX=10116 GN=Cd79b PE=4 SV=1
6	P11912	1.53e-09	58.2	226	0.227	0.230	CD79A_HUMAN B-cell antigen receptor complex-associated protein alpha chain OS=Homo sapiens OX=9606 GN=CD79A PE=1 SV=2
7	P11911	4.46e-08	53.9	220	0.197	0.205	CD79A_MOUSE B-cell antigen receptor complex-associated protein alpha chain OS=Mus musculus OX=10090 GN=Cd79a PE=1 SV=2
8	P10966	0.004	39.7	210	0.166	0.181	CD8B_HUMAN T-cell surface glycoprotein CD8 beta chain OS=Homo sapiens OX=9606 GN=CD8B PE=1 SV=1
9	Q6PIQ7	0.004	39.7	236	0.140	0.136	Q6PIQ7_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
10	Q8BNV8	0.005	39.3	229	0.114	0.114	Q8BNV8_MOUSE Plasmacytoid dendritic cell-specific receptor OS=Mus musculus OX=10090 GN=A530064D06Rik PE=1 SV=1
11	P04210	0.006	37.7	113	0.105	0.212	LV1_CHICK Ig lambda chain V-1 region OS=Gallus gallus OX=9031 PE=4 SV=1
12	A0A8I6A2S5	0.011	39.3	4402	0.114	0.006	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
13	A0A8I6ASH2	0.011	39.3	4387	0.114	0.006	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
14	F1LTJ5	0.011	39.3	2438	0.114	0.011	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
15	Q8VIJ0	0.030	35.8	108	0.135	0.287	Q8VIJ0_MOUSE Anti-DNA light chain (Fragment) OS=Mus musculus OX=10090 GN=Igkv6-14 PE=2 SV=1
16	A0A8I6A1P7	0.039	37.4	1377	0.231	0.038	A0A8I6A1P7_RAT Roundabout guidance receptor 2 OS=Rattus norvegicus OX=10116 GN=Robo2 PE=4 SV=1
17	P01601	0.046	35.4	117	0.118	0.231	KVD16_HUMAN Immunoglobulin kappa variable 1D-16 OS=Homo sapiens OX=9606 GN=IGKV1D-16 PE=3 SV=2
18	Q8N355	0.046	36.6	234	0.166	0.162	Q8N355_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
19	Q6PIK1	0.048	36.6	235	0.070	0.068	Q6PIK1_HUMAN IGL@ protein OS=Homo sapiens OX=9606 GN=IGL@ PE=1 SV=1
20	Q9QZI3	0.048	37.0	1060	0.231	0.050	Q9QZI3_RAT Robo2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Robo2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	3.8e+02	12.3	Adenovirus E3 region protein CR1
2	PF07679 I-set	0.011	27.1	Immunoglobulin I-set domain
3	PF00047 ig	0.84	21.2	Immunoglobulin domain
4	PF13895 Ig_2	19	16.9	Immunoglobulin domain
5	PF13927 Ig_3	0.069	25.0	Immunoglobulin domain
6	PF16680 Ig_4	3.5e+02	13.2	T-cell surface glycoprotein CD3 delta chain
7	PF18452 Ig_6	3.5	18.9	Immunoglobulin domain
8	PF02189 ITAM	2.4	19.9	Immunoreceptor tyrosine-based activation motif
9	PF07686 V-set	1.3e-06	40.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000016191

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000053635	0.950	Uncharacterized protein
2	9598.ENSPTRP00000018954	0.930	Uncharacterized protein
3	9598.ENSPTRP00000036060	0.929	Spleen tyrosine kinase
4	9598.ENSPTRP00000046608	0.909	Tyrosine-protein kinase
5	9598.ENSPTRP00000004883	0.903	Uncharacterized protein
6	9598.ENSPTRP00000018557	0.881	Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins
7	9598.ENSPTRP00000038032	0.867	Bruton agammaglobulinemia tyrosine kinase
8	9598.ENSPTRP00000035770	0.841	Uncharacterized protein
9	9598.ENSPTRP00000021008	0.840	Zeta-chain (TCR) associated protein kinase 70kDa
10	9598.ENSPTRP00000014330	0.839	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
11	9598.ENSPTRP00000003034	0.828	Uncharacterized protein
12	9598.ENSPTRP00000048521	0.816	BLK proto-oncogene, Src family tyrosine kinase
13	9598.ENSPTRP00000022311	0.778	Inositol polyphosphate-5-phosphatase, 145kDa
14	9598.ENSPTRP00000027058	0.774	B-cell CLL/lymphoma 6
15	9598.ENSPTRP00000007332	0.752	Uncharacterized protein
16	9598.ENSPTRP00000043391	0.749	Uncharacterized protein
17	9598.ENSPTRP00000031615	0.740	Tyrosine-protein kinase
18	9598.ENSPTRP00000023178	0.739	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
19	9598.ENSPTRP00000050501	0.733	Protein tyrosine phosphatase, non-receptor type 6
20	9598.ENSPTRP00000016382	0.721	Pan troglodytes growth factor receptor-bound protein 2 (GRB2), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0038023	0.796	signaling receptor activity
GO:0005102	0.731	signaling receptor binding
GO:0004888	0.622	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.996	cellular response to stimulus
GO:0007165	0.989	signal transduction
GO:0002376	0.987	immune system process
GO:0048518	0.795	positive regulation of biological process
GO:0006955	0.606	immune response
GO:0048583	0.567	regulation of response to stimulus
GO:0007166	0.508	cell surface receptor signaling pathway
GO:0002682	0.460	regulation of immune system process
GO:0002684	0.425	positive regulation of immune system process
GO:0002768	0.393	immune response-regulating cell surface receptor signaling pathway
GO:0048584	0.377	positive regulation of response to stimulus
GO:0050778	0.353	positive regulation of immune response
GO:0002757	0.340	immune response-activating signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.987	membrane-bounded organelle
GO:0005576	0.973	extracellular region
GO:0031982	0.896	vesicle
GO:0005622	0.838	intracellular anatomical structure
GO:0005615	0.825	extracellular space
GO:0070062	0.788	extracellular exosome
GO:0032991	0.770	protein-containing complex
GO:0043231	0.728	intracellular membrane-bounded organelle
GO:0005737	0.719	cytoplasm
GO:0009986	0.403	cell surface
GO:0043235	0.363	receptor complex
GO:0098796	0.344	membrane protein complex
GO:0098797	0.306	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]