StarFunc result for job id P40261

User Input

>input (264 residues)
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40261	1.000	1.000	1.688E-57	264	1.000	1.000	P40261.pdb.gz	NNMT_HUMAN Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1
2	PDB:6orrC	0.977	0.945	5.655E-52	273	0.981	0.949	6orrC.pdb.gz	High-Affinity Alkynyl Bisubstrate Inhibitors of NicotinamideN-Methyltransferase (NNMT).
3	AFDB:D4A605	0.990	0.990	1.652E-51	264	0.856	0.856	D4A605.pdb.gz	D4A605_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=3 SV=1
4	PDB:2i62B	0.973	0.984	5.260E-48	261	0.837	0.847	2i62B.pdb.gz	The Crystal Structure of Mouse Nicotinamide N-methyltransferase in complex with SAH
5	AFDB:O95050	0.980	0.984	7.192E-39	263	0.530	0.532	O95050.pdb.gz	INMT_HUMAN Indolethylamine N-methyltransferase OS=Homo sapiens OX=9606 GN=INMT PE=1 SV=3
6	AFDB:P40936	0.967	0.967	5.036E-37	264	0.519	0.519	P40936.pdb.gz	INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus OX=10090 GN=Inmt PE=1 SV=1
7	PDB:2a14A	0.953	0.979	6.203E-37	257	0.515	0.529	2a14A.pdb.gz	The Crystal Structure of Human Indolethylamine N-methyltransferase in complex with SAH.
8	AFDB:P40935	0.906	0.813	2.826E-30	295	0.386	0.346	P40935.pdb.gz	PNMT_MOUSE Phenylethanolamine N-methyltransferase OS=Mus musculus OX=10090 GN=Pnmt PE=1 SV=1
9	AFDB:P10938	0.910	0.851	8.541E-30	283	0.379	0.353	P10938.pdb.gz	PNMT_BOVIN Phenylethanolamine N-methyltransferase OS=Bos taurus OX=9913 GN=PNMT PE=1 SV=2
10	AFDB:A0A5F8AH41	0.906	0.850	1.361E-29	282	0.383	0.358	A0A5F8AH41.pdb.gz	PNMT_MACMU Phenylethanolamine N-methyltransferase OS=Macaca mulatta OX=9544 GN=PNMT PE=1 SV=1
11	PDB:2an3B	0.901	0.884	1.581E-29	269	0.383	0.375	2an3B.pdb.gz	Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
12	AFDB:P34254	0.813	0.787	3.997E-21	273	0.258	0.249	P34254.pdb.gz	NNMT1_CAEEL Nicotinamide N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=anmt-1 PE=3 SV=1
13	AFDB:O74386	0.558	0.589	1.765E-12	248	0.201	0.214	O74386.pdb.gz	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
14	AFDB:Q6NN40	0.591	0.568	1.520E-11	276	0.129	0.123	Q6NN40.pdb.gz	NTM1_DROME Alpha N-terminal protein methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Ntmt PE=1 SV=1
15	PDB:7ezgA	0.541	0.524	2.814E-11	275	0.155	0.149	7ezgA.pdb.gz	Crystal structure of human METTL6, the m 3 C methyltransferase.
16	PDB:4hh4C	0.569	0.585	4.094E-10	256	0.117	0.121	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.
17	PDB:6dtnB	0.531	0.592	1.561E-9	233	0.133	0.150	6dtnB.pdb.gz	Discovery of Bisubstrate Inhibitors for Protein N-Terminal Methyltransferase 1.
18	PDB:1nbhA	0.554	0.506	9.487E-9	292	0.186	0.168	1nbhA.pdb.gz	Catalytic mechanism of glycine N-methyltransferase
19	PDB:1qzzA	0.504	0.402	1.197E-8	340	0.136	0.106	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
20	PDB:4qnxB	0.459	0.385	1.602E-8	322	0.155	0.127	4qnxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40261	0.0	544	264	1.000	1.000	NNMT_HUMAN Nicotinamide N-methyltransferase OS=Homo sapiens OX=9606 GN=NNMT PE=1 SV=1
2	D4A605	2.75e-169	469	264	0.856	0.856	D4A605_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=3 SV=1
3	O55239	1.87e-167	465	264	0.848	0.848	NNMT_MOUSE Nicotinamide N-methyltransferase OS=Mus musculus OX=10090 GN=Nnmt PE=1 SV=1
4	P40936	7.06e-94	279	264	0.511	0.511	INMT_MOUSE Indolethylamine N-methyltransferase OS=Mus musculus OX=10090 GN=Inmt PE=1 SV=1
5	O95050	3.11e-91	272	263	0.530	0.532	INMT_HUMAN Indolethylamine N-methyltransferase OS=Homo sapiens OX=9606 GN=INMT PE=1 SV=3
6	A0A8I6A6E7	6.03e-89	262	156	0.481	0.814	A0A8I6A6E7_RAT Nicotinamide N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Nnmt PE=1 SV=1
7	A0A5F8AH41	2.93e-55	181	282	0.386	0.362	PNMT_MACMU Phenylethanolamine N-methyltransferase OS=Macaca mulatta OX=9544 GN=PNMT PE=1 SV=1
8	P10937	1.41e-54	179	285	0.383	0.354	PNMT_RAT Phenylethanolamine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Pnmt PE=1 SV=3
9	P40935	1.95e-54	179	295	0.383	0.342	PNMT_MOUSE Phenylethanolamine N-methyltransferase OS=Mus musculus OX=10090 GN=Pnmt PE=1 SV=1
10	P11086	6.76e-54	177	282	0.375	0.351	PNMT_HUMAN Phenylethanolamine N-methyltransferase OS=Homo sapiens OX=9606 GN=PNMT PE=1 SV=1
11	P10938	3.28e-53	176	283	0.379	0.353	PNMT_BOVIN Phenylethanolamine N-methyltransferase OS=Bos taurus OX=9913 GN=PNMT PE=1 SV=2
12	P34254	2.28e-23	97.8	273	0.265	0.256	NNMT1_CAEEL Nicotinamide N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=anmt-1 PE=3 SV=1
13	Q9P7L6	8.76e-04	42.4	307	0.178	0.153	TR140_SCHPO tRNA N(3)-methylcytidine methyltransferase trm140 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm140 PE=1 SV=2
14	Q8TCB7	0.049	37.0	284	0.087	0.081	METL6_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL6 OS=Homo sapiens OX=9606 GN=METTL6 PE=1 SV=2
15	O74386	0.40	33.9	248	0.087	0.093	TR141_SCHPO tRNA N(3)-methylcytidine methyltransferase trm141 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trm141 PE=1 SV=1
16	P0DO30	0.75	33.9	4036	0.053	0.003	ILIA_NEOS2 Hybrid PKS-NRPS synthetase iliA OS=Neonectria sp. (strain DH2) OX=1735992 GN=iliA PE=1 SV=1
17	Q96IZ6	0.89	33.1	378	0.076	0.053	MET2A_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2A OS=Homo sapiens OX=9606 GN=METTL2A PE=1 SV=5
18	Q6P1Q9	1.2	32.7	378	0.076	0.053	MET2B_HUMAN tRNA N(3)-methylcytidine methyltransferase METTL2B OS=Homo sapiens OX=9606 GN=METTL2B PE=1 SV=3
19	Q8BMK1	1.2	32.7	389	0.080	0.054	METL2_MOUSE tRNA N(3)-methylcytidine methyltransferase METTL2 OS=Mus musculus OX=10090 GN=Mettl2 PE=1 SV=2
20	Q9LXB3	2.0	32.3	500	0.102	0.054	Q9LXB3_ARATH Cytochrome P450, family 81, subfamily K, polypeptide 1 OS=Arabidopsis thaliana OX=3702 GN=CYP81K1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	3.8	19.5	Methyltransferase domain
2	PF08242 Methyltransf_12	6.1	19.0	Methyltransferase domain
3	PF13489 Methyltransf_23	0.044	25.1	Methyltransferase domain
4	PF13649 Methyltransf_25	1.3	21.1	Methyltransferase domain
5	PF01234 NNMT_PNMT_TEMT	7e-105	361.4	NNMT/PNMT/TEMT family
6	PF01209 Ubie_methyltran	1.6e+02	13.0	ubiE/COQ5 methyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349541	0.984	Caveolae-associated protein 1
2	9606.ENSP00000363832	0.954	Aldehyde oxidase
3	9606.ENSP00000275493	0.952	Epidermal growth factor receptor
4	9606.ENSP00000386665	0.951	Four and a half LIM domains protein 2
5	9606.ENSP00000222553	0.950	Nicotinamide phosphoribosyltransferase
6	9606.ENSP00000212015	0.944	NAD-dependent protein deacetylase sirtuin-1
7	9606.ENSP00000476228	0.944	NAD-dependent protein deacylase sirtuin-5, mitochondrial
8	9606.ENSP00000202967	0.943	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
9	9606.ENSP00000329466	0.943	NAD-dependent protein deacetylase sirtuin-7
10	9606.ENSP00000372191	0.943	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
11	9606.ENSP00000249396	0.942	NAD-dependent protein deacetylase sirtuin-2
12	9606.ENSP00000357801	0.941	Protein S100-A10
13	9606.ENSP00000337332	0.940	NAD-dependent protein deacetylase sirtuin-6
14	9606.ENSP00000265016	0.927	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
15	9606.ENSP00000226279	0.922	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
16	9606.ENSP00000354532	0.918	Purine nucleoside phosphorylase
17	9606.ENSP00000384537	0.763	A-kinase anchor protein 12
18	9606.ENSP00000432282	0.664	Transgelin
19	9606.ENSP00000371634	0.633	Insulin-like growth factor 2 mRNA-binding protein 2
20	9606.ENSP00000365777	0.610	Methylenetetrahydrofolate reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008757	1.000	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	1.000	N-methyltransferase activity
GO:0005488	0.887	binding
GO:0005515	0.854	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0006807	0.968	nitrogen compound metabolic process
GO:0044237	0.966	cellular metabolic process
GO:0065007	0.923	biological regulation
GO:1901564	0.899	organonitrogen compound metabolic process
GO:0050794	0.889	regulation of cellular process
GO:0044238	0.755	primary metabolic process
GO:1901360	0.704	organic cyclic compound metabolic process
GO:0019222	0.699	regulation of metabolic process
GO:0046483	0.689	heterocycle metabolic process
GO:0034641	0.633	cellular nitrogen compound metabolic process
GO:0080090	0.603	regulation of primary metabolic process
GO:0050896	0.589	response to stimulus
GO:0060255	0.589	regulation of macromolecule metabolic process
GO:0032259	0.588	methylation
GO:0051171	0.582	regulation of nitrogen compound metabolic process
GO:0031323	0.568	regulation of cellular metabolic process
GO:0051246	0.524	regulation of protein metabolic process
GO:0044281	0.504	small molecule metabolic process
GO:0006725	0.432	cellular aromatic compound metabolic process
GO:0072524	0.373	pyridine-containing compound metabolic process
GO:0048518	0.359	positive regulation of biological process
GO:0044249	0.328	cellular biosynthetic process
GO:1901576	0.320	organic substance biosynthetic process
GO:0032502	0.305	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0043233	0.596	organelle lumen
GO:0070013	0.594	intracellular organelle lumen
GO:0043231	0.319	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.

[back to server]