StarFunc result for job id P40305

User Input

>input (122 residues)
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAG
IASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIAR
FY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40305	1.000	1.000	1.428E-15	122	1.000	1.000	P40305.pdb.gz	IFI27_HUMAN Interferon alpha-inducible protein 27, mitochondrial OS=Homo sapiens OX=9606 GN=IFI27 PE=1 SV=4
2	AFDB:P09912	0.352	0.337	7.335E-2	130	0.328	0.308	P09912.pdb.gz	IFI6_HUMAN Interferon alpha-inducible protein 6 OS=Homo sapiens OX=9606 GN=IFI6 PE=1 SV=2
3	PDB:6ta5D	0.331	0.134	7.007	345	0.082	0.029	6ta5D.pdb.gz
4	AFDB:A1Z7T0	0.279	0.048	8.253	1190	0.082	0.008	A1Z7T0.pdb.gz	PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster OX=7227 GN=Pkn PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40305	1.39e-73	216	122	1.000	1.000	IFI27_HUMAN Interferon alpha-inducible protein 27, mitochondrial OS=Homo sapiens OX=9606 GN=IFI27 PE=1 SV=4
2	Q6P9X5	8.56e-24	92.0	182	0.467	0.313	Q6P9X5_RAT Interferon, alpha-inducible protein 27-like OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=2 SV=1
3	G3V761	3.26e-23	90.5	182	0.459	0.308	G3V761_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
4	A0A8I5ZTN9	7.55e-23	90.5	209	0.443	0.258	A0A8I5ZTN9_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
5	D3ZIG6	4.38e-22	87.8	179	0.459	0.313	D3ZIG6_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=3
6	Q9D1E1	1.36e-21	87.4	215	0.451	0.256	Q9D1E1_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
7	Q3UK07	1.52e-21	87.0	215	0.451	0.256	Q3UK07_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
8	Q70LN3	3.72e-21	87.0	260	0.451	0.212	Q70LN3_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
9	Q8C6G0	3.84e-21	87.0	260	0.451	0.212	Q8C6G0_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=2
10	Q8R412	8.94e-21	81.6	90	0.385	0.522	IF27A_MOUSE Interferon alpha-inducible protein 27-like protein 2A OS=Mus musculus OX=10090 GN=Ifi27l2a PE=2 SV=1
11	Q70LM9	4.15e-20	82.0	165	0.418	0.309	Q70LM9_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
12	Q70LN0	5.30e-20	82.8	205	0.426	0.254	Q70LN0_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
13	Q96BM0	4.45e-19	77.8	104	0.393	0.462	I27L1_HUMAN Interferon alpha-inducible protein 27-like protein 1 OS=Homo sapiens OX=9606 GN=IFI27L1 PE=1 SV=1
14	Q70LN2	5.14e-19	81.3	250	0.418	0.204	Q70LN2_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
15	E9Q1C5	5.25e-19	81.3	250	0.418	0.204	E9Q1C5_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
16	Q9H2X8	1.95e-18	77.0	130	0.418	0.392	I27L2_HUMAN Interferon alpha-inducible protein 27-like protein 2 OS=Homo sapiens OX=9606 GN=IFI27L2 PE=2 SV=1
17	P09912	2.87e-14	66.2	130	0.328	0.308	IFI6_HUMAN Interferon alpha-inducible protein 6 OS=Homo sapiens OX=9606 GN=IFI6 PE=1 SV=2
18	Q8VC49	2.17e-07	50.1	283	0.426	0.184	IF27B_MOUSE Interferon alpha-inducible protein 27-like protein 2B OS=Mus musculus OX=10090 GN=Ifi27l2b PE=1 SV=1
19	D3Z4L8	0.50	30.8	105	0.213	0.248	D3Z4L8_MOUSE Interferon, alpha-inducible protein 27 (Fragment) OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
20	A0A8I5ZNJ3	1.2	30.4	175	0.123	0.086	A0A8I5ZNJ3_RAT Adhesion G protein-coupled receptor V1 OS=Rattus norvegicus OX=10116 GN=Adgrv1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06140 Ifi-6-16	5.9e-26	101.5	Interferon-induced 6-16 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368699	0.994	Ubiquitin-like protein ISG15
2	9606.ENSP00000381601	0.988	Interferon-induced GTP-binding protein Mx1
3	9606.ENSP00000371471	0.984	Radical S-adenosyl methionine domain-containing protein 2
4	9606.ENSP00000342513	0.978	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
5	9606.ENSP00000388001	0.978	2'-5'-oligoadenylate synthase 1
6	9606.ENSP00000360869	0.976	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000257570	0.968	2'-5'-oligoadenylate synthase-like protein
8	9606.ENSP00000386187	0.968	Interferon-induced transmembrane protein 1
9	9606.ENSP00000380697	0.967	Interferon regulatory factor 7
10	9606.ENSP00000360883	0.966	Interferon-induced protein with tetratricopeptide repeats 3
11	9606.ENSP00000395590	0.963	Interferon-induced 35 kDa protein
12	9606.ENSP00000342278	0.962	2'-5'-oligoadenylate synthase 2
13	9606.ENSP00000228928	0.961	2'-5'-oligoadenylate synthase 3
14	9606.ENSP00000360891	0.961	Interferon-induced protein with tetratricopeptide repeats 2
15	9606.ENSP00000306565	0.958	Interferon-stimulated gene 20 kDa protein
16	9606.ENSP00000354822	0.958	XIAP-associated factor 1
17	9606.ENSP00000360860	0.958	Interferon-induced protein with tetratricopeptide repeats 5
18	9606.ENSP00000380073	0.958	Interferon regulatory factor 9
19	9606.ENSP00000382707	0.958	Interferon-induced transmembrane protein 3
20	9606.ENSP00000333657	0.957	Interferon-induced GTP-binding protein Mx2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0005521	1.000	lamin binding
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0009987	0.985	cellular process
GO:0034097	0.889	response to cytokine
GO:0051707	0.871	response to other organism
GO:0098542	0.857	defense response to other organism
GO:0009615	0.850	response to virus
GO:0051716	0.836	cellular response to stimulus
GO:0019222	0.833	regulation of metabolic process
GO:0048519	0.803	negative regulation of biological process
GO:0008219	0.796	cell death
GO:0060255	0.783	regulation of macromolecule metabolic process
GO:0002376	0.748	immune system process
GO:0006955	0.707	immune response
GO:0010468	0.696	regulation of gene expression
GO:0140546	0.682	defense response to symbiont
GO:0051171	0.675	regulation of nitrogen compound metabolic process
GO:0080090	0.670	regulation of primary metabolic process
GO:0051607	0.647	defense response to virus
GO:0007154	0.643	cell communication
GO:0023052	0.633	signaling
GO:0031323	0.632	regulation of cellular metabolic process
GO:0007165	0.624	signal transduction
GO:0048523	0.610	negative regulation of cellular process
GO:0019219	0.607	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.587	regulation of RNA metabolic process
GO:0045087	0.587	innate immune response
GO:0071345	0.521	cellular response to cytokine stimulus
GO:0071704	0.504	organic substance metabolic process
GO:0044238	0.479	primary metabolic process
GO:0032879	0.459	regulation of localization
GO:0010556	0.415	regulation of macromolecule biosynthetic process
GO:0031326	0.415	regulation of cellular biosynthetic process
GO:0006355	0.409	regulation of DNA-templated transcription
GO:0007166	0.390	cell surface receptor signaling pathway
GO:0006807	0.385	nitrogen compound metabolic process
GO:0012501	0.381	programmed cell death
GO:0048518	0.321	positive regulation of biological process
GO:0046822	0.317	regulation of nucleocytoplasmic transport
GO:0033157	0.305	regulation of intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031966	1.000	mitochondrial membrane
GO:0012505	0.997	endomembrane system
GO:0019866	0.991	organelle inner membrane
GO:0098588	0.983	bounding membrane of organelle
GO:0019867	0.916	outer membrane
GO:0031965	0.908	nuclear membrane
GO:0031968	0.907	organelle outer membrane
GO:0005741	0.903	mitochondrial outer membrane
GO:0005637	0.897	nuclear inner membrane
GO:0070013	0.509	intracellular organelle lumen
GO:0005829	0.502	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]