StarFunc result for job id P40337

User Input

>input (213 residues)
MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPR
PVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFR
DAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDI
VRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2F2	0.786	0.786	2.695E-39	213	1.000	1.000	A0A024R2F2.pdb.gz	A0A024R2F2_HUMAN von Hippel-Lindau tumor suppressor isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=VHL PE=2 SV=1
2	AFDB:Q64259	0.753	0.866	6.323E-33	185	0.723	0.832	Q64259.pdb.gz	VHL_RAT von Hippel-Lindau disease tumor suppressor OS=Rattus norvegicus OX=10116 GN=Vhl PE=1 SV=1
3	PDB:4wqoA	0.683	0.979	1.740E-29	148	0.690	0.993	4wqoA.pdb.gz
4	AFDB:A1L296	0.710	0.861	5.222E-22	175	0.380	0.463	A1L296.pdb.gz	A1L296_DANRE Zgc:158722 OS=Danio rerio OX=7955 GN=zgc:158722 PE=2 SV=1
5	AFDB:A0A0S2Z4K1	0.443	0.537	5.897E-22	172	0.808	1.000	A0A0S2Z4K1.pdb.gz	A0A0S2Z4K1_HUMAN von Hippel-Lindau tumor suppressor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VHL PE=2 SV=1
6	AFDB:Q6RSH7	0.481	0.729	7.452E-17	139	0.385	0.590	Q6RSH7.pdb.gz	VHLL_HUMAN von Hippel-Lindau-like protein OS=Homo sapiens OX=9606 GN=VHLL PE=1 SV=1
7	AFDB:Q19213	0.561	0.680	4.057E-11	174	0.183	0.224	Q19213.pdb.gz	VHL_CAEEL von Hippel-Lindau tumor suppressor homolog OS=Caenorhabditis elegans OX=6239 GN=vhl-1 PE=1 SV=1
8	AFDB:Q9V3C1	0.485	0.569	5.229E-10	178	0.160	0.191	Q9V3C1.pdb.gz	VHL_DROME Protein Vhl OS=Drosophila melanogaster OX=7227 GN=Vhl PE=1 SV=1
9	AFDB:O53572	0.102	0.088	2.143E-2	264	0.122	0.098	O53572.pdb.gz	O53572_MYCTU Probable conserved membrane protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3587c PE=1 SV=3
10	PDB:2wskA	0.195	0.072	3.514E-2	654	0.042	0.014	2wskA.pdb.gz
11	PDB:5gai0	0.133	0.052	3.735E-2	662	0.066	0.021	5gai0.pdb.gz
12	AFDB:Q6ZY51	0.173	0.048	4.729E-2	1196	0.085	0.015	Q6ZY51.pdb.gz	PWD_ARATH Phosphoglucan, water dikinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GWD3 PE=1 SV=1
13	AFDB:A1Z7Q8	0.200	0.140	6.032E-2	341	0.131	0.082	A1Z7Q8.pdb.gz	A1Z7Q8_DROME Alicorn, isoform A OS=Drosophila melanogaster OX=7227 GN=alc PE=1 SV=1
14	PDB:1m3jA	0.174	0.092	7.295E-2	471	0.052	0.023	1m3jA.pdb.gz
15	PDB:5tthA	0.209	0.077	1.262E-1	671	0.047	0.015	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
16	PDB:4bctA	0.171	0.181	1.818E-1	201	0.042	0.045	4bctA.pdb.gz
17	PDB:7nqkA	0.165	0.066	1.818E-1	658	0.089	0.029	7nqkA.pdb.gz
18	PDB:6d10A	0.276	0.563	2.182E-1	89	0.047	0.112	6d10A.pdb.gz
19	PDB:5ttdA	0.211	0.108	4.262E-1	491	0.038	0.016	5ttdA.pdb.gz	Engineering a Lys-Asn isopeptide bond into an immunoglobulin-like protein domain enhances its stability.
20	PDB:7pmxA	0.213	0.082	4.529E-1	657	0.047	0.015	7pmxA.pdb.gz	Structural snapshots of human PepT1 and PepT2 reveal mechanistic insights into substrate and drug transport across epithelial membranes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R2F2	1.06e-155	431	213	1.000	1.000	A0A024R2F2_HUMAN von Hippel-Lindau tumor suppressor isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=VHL PE=2 SV=1
2	P40337	1.06e-155	431	213	1.000	1.000	VHL_HUMAN von Hippel-Lindau disease tumor suppressor OS=Homo sapiens OX=9606 GN=VHL PE=1 SV=2
3	A0A0S2Z4K1	3.58e-114	325	172	0.808	1.000	A0A0S2Z4K1_HUMAN von Hippel-Lindau tumor suppressor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VHL PE=2 SV=1
4	Q64259	1.90e-111	318	185	0.723	0.832	VHL_RAT von Hippel-Lindau disease tumor suppressor OS=Rattus norvegicus OX=10116 GN=Vhl PE=1 SV=1
5	P40338	1.16e-107	308	181	0.704	0.829	VHL_MOUSE von Hippel-Lindau disease tumor suppressor OS=Mus musculus OX=10090 GN=Vhl PE=1 SV=1
6	A1L296	1.02e-50	164	175	0.376	0.457	A1L296_DANRE Zgc:158722 OS=Danio rerio OX=7955 GN=zgc:158722 PE=2 SV=1
7	Q6RSH7	8.83e-49	157	139	0.394	0.604	VHLL_HUMAN von Hippel-Lindau-like protein OS=Homo sapiens OX=9606 GN=VHLL PE=1 SV=1
8	Q9V3C1	4.99e-04	41.6	178	0.146	0.174	VHL_DROME Protein Vhl OS=Drosophila melanogaster OX=7227 GN=Vhl PE=1 SV=1
9	Q19213	0.002	39.7	174	0.136	0.167	VHL_CAEEL von Hippel-Lindau tumor suppressor homolog OS=Caenorhabditis elegans OX=6239 GN=vhl-1 PE=1 SV=1
10	Q12019	0.29	34.7	4910	0.127	0.005	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
11	A0A5F9UY30	0.42	33.9	453	0.122	0.057	A0A5F9UY30_HUMAN Trans-golgi network protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=1
12	O43493	0.47	33.5	437	0.122	0.059	TGON2_HUMAN Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=4
13	P41002	2.5	31.6	786	0.099	0.027	CCNF_HUMAN Cyclin-F OS=Homo sapiens OX=9606 GN=CCNF PE=1 SV=2
14	Q64398	2.6	31.6	1154	0.075	0.014	DGKH_MESAU Diacylglycerol kinase eta OS=Mesocricetus auratus OX=10036 GN=DGKH PE=1 SV=1
15	Q5B0N1	2.9	31.2	1179	0.099	0.018	Q5B0N1_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05899 PE=3 SV=1
16	C0H4M0	3.2	31.2	861	0.094	0.023	C0H4M0_PLAF7 Rhoptry-associated membrane antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0707300 PE=4 SV=1
17	B9ZSJ2	3.9	30.8	1463	0.080	0.012	B9ZSJ2_PLAF7 Exported protein family 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0114000 PE=4 SV=1
18	Q9LF37	5.3	30.4	968	0.122	0.027	CLPB3_ARATH Chaperone protein ClpB3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPB3 PE=1 SV=1
19	Q498T9	6.8	30.0	803	0.094	0.025	LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus OX=10116 GN=Lrrc8c PE=1 SV=1
20	Q8R502	6.8	30.0	803	0.094	0.025	LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus OX=10090 GN=Lrrc8c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01847 VHL	2.6e-40	147.6	VHL beta domain
2	PF17211 VHL_C	5.4e-26	101.5	VHL box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000262306	0.999	Elongin-B
3	9606.ENSP00000263734	0.999	Endothelial PAS domain-containing protein 1
4	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
5	9606.ENSP00000444856	0.999	Cullin-2
6	9606.ENSP00000478121	0.999	Elongin-C
7	9606.ENSP00000346839	0.997	Fibronectin type III domain containing
8	9606.ENSP00000355601	0.990	Egl nine homolog 1
9	9606.ENSP00000262971	0.971	E3 SUMO-protein ligase PIAS4
10	9606.ENSP00000478570	0.971	Vascular endothelial growth factor A
11	9606.ENSP00000226319	0.969	Protein Jade-1
12	9606.ENSP00000250495	0.966	NEDD8
13	9606.ENSP00000286428	0.962	Prefoldin subunit 3
14	9606.ENSP00000351407	0.962	Aryl hydrocarbon receptor nuclear translocator
15	9606.ENSP00000263253	0.942	Histone acetyltransferase p300
16	9606.ENSP00000269305	0.941	Cellular tumor antigen p53
17	9606.ENSP00000348056	0.938	SUMO-conjugating enzyme UBC9
18	9606.ENSP00000350512	0.923	COP9 signalosome complex subunit 5
19	9606.ENSP00000250457	0.917	Egl nine homolog 3
20	9606.ENSP00000359829	0.905	Ubiquitin carboxyl-terminal hydrolase 33

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.998	ubiquitin-protein transferase activity
GO:0008134	0.963	transcription factor binding
GO:0019899	0.944	enzyme binding
GO:0140767	0.937	enzyme-substrate adaptor activity
GO:1990756	0.901	ubiquitin ligase-substrate adaptor activity
GO:0140110	0.832	transcription regulator activity
GO:0044877	0.810	protein-containing complex binding
GO:0140297	0.759	DNA-binding transcription factor binding
GO:0003712	0.740	transcription coregulator activity
GO:0003714	0.658	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0009987	0.991	cellular process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0080090	0.991	regulation of primary metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0050896	0.987	response to stimulus
GO:0048522	0.983	positive regulation of cellular process
GO:0031323	0.982	regulation of cellular metabolic process
GO:1901564	0.977	organonitrogen compound metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0070482	0.966	response to oxygen levels
GO:0048519	0.966	negative regulation of biological process
GO:0044238	0.965	primary metabolic process
GO:0048523	0.964	negative regulation of cellular process
GO:0019219	0.957	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.955	negative regulation of macromolecule metabolic process
GO:0042221	0.948	response to chemical
GO:0006950	0.948	response to stress
GO:0009966	0.942	regulation of signal transduction
GO:0009894	0.940	regulation of catabolic process
GO:0043170	0.927	macromolecule metabolic process
GO:0010556	0.925	regulation of macromolecule biosynthetic process
GO:0031326	0.925	regulation of cellular biosynthetic process
GO:0006355	0.919	regulation of DNA-templated transcription
GO:0051172	0.885	negative regulation of nitrogen compound metabolic process
GO:0051253	0.882	negative regulation of RNA metabolic process
GO:0009968	0.874	negative regulation of signal transduction
GO:1903507	0.872	negative regulation of nucleic acid-templated transcription
GO:0009893	0.866	positive regulation of metabolic process
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0006357	0.854	regulation of transcription by RNA polymerase II
GO:0045892	0.853	negative regulation of DNA-templated transcription
GO:0051173	0.852	positive regulation of nitrogen compound metabolic process
GO:0044237	0.839	cellular metabolic process
GO:0051247	0.815	positive regulation of protein metabolic process
GO:0019538	0.813	protein metabolic process
GO:0030162	0.809	regulation of proteolysis
GO:0051716	0.807	cellular response to stimulus
GO:0031329	0.784	regulation of cellular catabolic process
GO:0031325	0.767	positive regulation of cellular metabolic process
GO:0009056	0.764	catabolic process
GO:0033554	0.681	cellular response to stress
GO:0000122	0.661	negative regulation of transcription by RNA polymerase II
GO:1903050	0.639	regulation of proteolysis involved in protein catabolic process
GO:0071840	0.633	cellular component organization or biogenesis
GO:0045862	0.631	positive regulation of proteolysis
GO:0006508	0.563	proteolysis
GO:0070887	0.554	cellular response to chemical stimulus
GO:0001666	0.535	response to hypoxia
GO:0016043	0.486	cellular component organization
GO:0036211	0.484	protein modification process
GO:0032784	0.447	regulation of DNA-templated transcription elongation
GO:1904892	0.423	regulation of receptor signaling pathway via STAT
GO:0042127	0.403	regulation of cell population proliferation
GO:1904893	0.403	negative regulation of receptor signaling pathway via STAT
GO:1903052	0.400	positive regulation of proteolysis involved in protein catabolic process
GO:0080134	0.399	regulation of response to stress
GO:0070647	0.396	protein modification by small protein conjugation or removal
GO:0080135	0.392	regulation of cellular response to stress
GO:0032502	0.347	developmental process
GO:0034243	0.341	regulation of transcription elongation by RNA polymerase II
GO:0009896	0.310	positive regulation of catabolic process
GO:0044248	0.307	cellular catabolic process
GO:0032501	0.303	multicellular organismal process
GO:0010629	0.303	negative regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.992	cytosol
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0032991	0.332	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]