StarFunc result for job id P40424

User Input

>input (430 residues)
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1MJ41	0.589	0.589	4.995E-51	430	1.000	1.000	A1MJ41.pdb.gz
2	AFDB:O35317	0.583	0.578	5.802E-44	434	0.844	0.836	O35317.pdb.gz	PBX3_MOUSE Pre-B-cell leukemia transcription factor 3 OS=Mus musculus OX=10090 GN=Pbx3 PE=1 SV=1
3	AFDB:Q5JS98	0.538	0.511	2.489E-43	455	0.842	0.796	Q5JS98.pdb.gz	Q5JS98_HUMAN PBX homeobox 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
4	AFDB:O35984	0.589	0.589	1.725E-38	430	0.767	0.767	O35984.pdb.gz	PBX2_MOUSE Pre-B-cell leukemia transcription factor 2 OS=Mus musculus OX=10090 GN=Pbx2 PE=1 SV=1
5	AFDB:H0YLF5	0.439	0.548	1.295E-36	339	0.788	1.000	H0YLF5.pdb.gz	H0YLF5_HUMAN PBX homeobox 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1
6	AFDB:B3DH36	0.444	0.472	6.006E-32	403	0.653	0.697	B3DH36.pdb.gz
7	AFDB:Q9BYU1	0.523	0.589	6.688E-31	374	0.595	0.684	Q9BYU1.pdb.gz	PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens OX=9606 GN=PBX4 PE=1 SV=2
8	AFDB:P40427	0.475	0.535	1.051E-30	376	0.614	0.702	P40427.pdb.gz	EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1
9	AFDB:Q99NE9	0.496	0.554	1.515E-28	378	0.535	0.608	Q99NE9.pdb.gz	PBX4_MOUSE Pre-B-cell leukemia transcription factor 4 OS=Mus musculus OX=10090 GN=Pbx4 PE=2 SV=2
10	AFDB:P41779	0.418	0.518	4.441E-25	338	0.428	0.544	P41779.pdb.gz	HM20_CAEEL Homeobox protein ceh-20 OS=Caenorhabditis elegans OX=6239 GN=ceh-20 PE=1 SV=1
11	PDB:4egcA	0.112	0.091	1.876E-2	539	0.088	0.071	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2p01A	0.124	0.156	6.304E-1	323	0.112	0.149	2p01A.pdb.gz
13	PDB:7vvuV	0.142	0.387	1.903	113	0.044	0.168	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
14	PDB:2hi3A	0.115	0.567	2.212	73	0.030	0.178	2hi3A.pdb.gz
15	PDB:3szrA	0.081	0.068	2.704	559	0.086	0.066	3szrA.pdb.gz
16	PDB:6pwnA	0.147	0.211	2.704	280	0.037	0.057	6pwnA.pdb.gz
17	PDB:7p34A	0.115	0.124	2.843	391	0.093	0.102	7p34A.pdb.gz	Molecular mechanism of SbmA, a promiscuous transporter exploited by antimicrobial peptides.
18	PDB:7ns4b	0.148	0.181	4.040	340	0.056	0.071	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
19	PDB:6q0xA	0.103	0.111	4.248	373	0.074	0.086	6q0xA.pdb.gz
20	PDB:7ax3A	0.114	0.092	4.939	587	0.102	0.075	7ax3A.pdb.gz	CryoEM structure of the super-constricted two-start dynamin 1 filament.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZR45	0.0	899	430	1.000	1.000	A0A8I5ZR45_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=1
2	A0A8I6AJF6	0.0	525	339	0.651	0.826	A0A8I6AJF6_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=1
3	B1WC30	0.0	697	347	0.774	0.960	B1WC30_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=1
4	F7EV88	0.0	835	406	0.930	0.985	F7EV88_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=2
5	H0YLF5	0.0	525	339	0.651	0.826	H0YLF5_HUMAN PBX homeobox 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1
6	O35317	0.0	698	434	0.847	0.839	PBX3_MOUSE Pre-B-cell leukemia transcription factor 3 OS=Mus musculus OX=10090 GN=Pbx3 PE=1 SV=1
7	O35984	0.0	619	430	0.740	0.740	PBX2_MOUSE Pre-B-cell leukemia transcription factor 2 OS=Mus musculus OX=10090 GN=Pbx2 PE=1 SV=1
8	P40424	0.0	899	430	1.000	1.000	PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1
9	P40425	0.0	610	430	0.737	0.737	PBX2_HUMAN Pre-B-cell leukemia transcription factor 2 OS=Homo sapiens OX=9606 GN=PBX2 PE=1 SV=2
10	P40426	0.0	696	434	0.844	0.836	PBX3_HUMAN Pre-B-cell leukemia transcription factor 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
11	P41778	0.0	899	430	1.000	1.000	PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 OS=Mus musculus OX=10090 GN=Pbx1 PE=1 SV=2
12	Q53YC7	0.0	697	347	0.774	0.960	Q53YC7_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=2 SV=1
13	Q5JS98	0.0	684	455	0.844	0.798	Q5JS98_HUMAN PBX homeobox 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
14	Q8QGC4	0.0	632	347	0.737	0.914	PBX1_XENLA Pre-B-cell leukemia transcription factor 1 OS=Xenopus laevis OX=8355 GN=pbx1 PE=1 SV=1
15	Q96AL5	0.0	573	367	0.705	0.826	Q96AL5_HUMAN PBX3 protein (Fragment) OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=2
16	Q9I9B6	0.0	619	346	0.723	0.899	Q9I9B6_DANRE Pbx1b homeodomain protein OS=Danio rerio OX=7955 GN=pbx1b PE=2 SV=1
17	Q9I9B7	0.0	798	428	0.926	0.930	Q9I9B7_DANRE Pbx1a homeodomain protein OS=Danio rerio OX=7955 GN=fi29e01 PE=2 SV=1
18	Q9PW77	0.0	542	343	0.644	0.808	Q9PW77_DANRE Pbx4 homeodomain protein OS=Danio rerio OX=7955 GN=fb77e11 PE=1 SV=1
19	Q9I9B4	3.19e-177	502	403	0.635	0.677	Q9I9B4_DANRE Pbxy homeodomain protein OS=Danio rerio OX=7955 GN=pbxy PE=1 SV=1
20	P40427	8.58e-176	498	376	0.605	0.691	EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	2.3e-12	57.9	Homeobox KN domain
2	PF00046 Homeodomain	4.5e-16	69.7	Homeodomain
3	PF01381 HTH_3	41	15.6	Helix-turn-helix
4	PF18517 LZ3wCH	5.1e+02	12.1	Leucine zipper with capping helix domain
5	PF03792 PBC	1.2e-84	294.2	PBC domain
6	PF04091 Sec15	51	14.7	Exocyst complex subunit Sec15-like
7	PF15943 YdaS_antitoxin	11	17.4	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008846444.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008836502.1	0.952	Homeobox protein Hox-B1
2	1026970.XP_008839731.1	0.947	Homeobox protein Hox-A9
3	1026970.XP_008825594.1	0.938	PBX/knotted 1 homeobox 1
4	1026970.XP_008839728.1	0.867	Homeobox A5
5	1026970.XP_008832047.1	0.838	Meis homeobox 1
6	1026970.XP_008823517.1	0.835	Homeobox protein Meis2 isoform X1
7	1026970.XP_008836511.1	0.825	Homeobox protein Hox-B8
8	1026970.XP_008824451.1	0.800	Protein kinase cAMP-activated catalytic subunit beta
9	1026970.XP_008853636.1	0.800	Protein kinase cAMP-activated catalytic subunit alpha
10	1026970.XP_008836510.1	0.796	Homeobox protein Hox-B7
11	1026970.XP_008839721.1	0.790	Homeobox protein Hox-A1 isoform X1
12	1026970.XP_008843037.1	0.763	E1A binding protein p300
13	1026970.XP_008823127.1	0.736	LIM homeobox transcription factor 1 beta
14	1026970.XP_008835361.1	0.711	Transcription factor E2-alpha isoform X1
15	1026970.XP_008837177.1	0.709	Homeobox protein Hox-C9
16	1026970.XP_008853532.1	0.709	Homeobox protein Hox-D9
17	1026970.XP_008822470.1	0.702	SMAD family member 4
18	1026970.XP_008831611.1	0.693	Myogenic differentiation 1
19	1026970.XP_008827658.1	0.686	Retinoic acid receptor alpha
20	1026970.XP_008853536.1	0.685	Homeobox D4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0008134	0.999	transcription factor binding
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.994	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.967	DNA-binding transcription activator activity
GO:0001228	0.944	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.941	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.863	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0032501	0.994	multicellular organismal process
GO:0050794	0.987	regulation of cellular process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031328	0.981	positive regulation of cellular biosynthetic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0010557	0.980	positive regulation of macromolecule biosynthetic process
GO:0007275	0.969	multicellular organism development
GO:0009987	0.966	cellular process
GO:0006355	0.939	regulation of DNA-templated transcription
GO:1903508	0.906	positive regulation of nucleic acid-templated transcription
GO:0048513	0.900	animal organ development
GO:0045893	0.899	positive regulation of DNA-templated transcription
GO:0048731	0.876	system development
GO:0006357	0.860	regulation of transcription by RNA polymerase II
GO:0009653	0.708	anatomical structure morphogenesis
GO:0048869	0.696	cellular developmental process
GO:0030154	0.694	cell differentiation
GO:0045944	0.555	positive regulation of transcription by RNA polymerase II
GO:0048468	0.430	cell development
GO:0009790	0.322	embryo development
GO:0009888	0.303	tissue development
GO:0009887	0.300	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.901	protein-containing complex
GO:0005737	0.615	cytoplasm
GO:0005667	0.574	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]