StarFunc result for job id P40426

User Input

>input (434 residues)
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS
LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV
SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH
VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR
NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD
SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS
PTEGPGSVHSDTSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35317	0.636	0.636	1.749E-54	434	0.998	0.998	O35317.pdb.gz	PBX3_MOUSE Pre-B-cell leukemia transcription factor 3 OS=Mus musculus OX=10090 GN=Pbx3 PE=1 SV=1
2	AFDB:Q5JS98	0.518	0.499	5.570E-52	455	1.000	0.954	Q5JS98.pdb.gz	Q5JS98_HUMAN PBX homeobox 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
3	AFDB:A1MJ41	0.471	0.475	4.160E-44	430	0.827	0.835	A1MJ41.pdb.gz
4	AFDB:Q9BYU1	0.485	0.554	2.159E-35	374	0.590	0.684	Q9BYU1.pdb.gz	PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens OX=9606 GN=PBX4 PE=1 SV=2
5	AFDB:B3DH36	0.444	0.477	8.886E-35	403	0.647	0.697	B3DH36.pdb.gz
6	AFDB:H0YLF5	0.432	0.545	8.457E-34	339	0.673	0.861	H0YLF5.pdb.gz	H0YLF5_HUMAN PBX homeobox 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1
7	AFDB:P40427	0.449	0.513	8.048E-33	376	0.611	0.705	P40427.pdb.gz	EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1
8	AFDB:Q99NE9	0.475	0.537	2.067E-32	378	0.532	0.611	Q99NE9.pdb.gz	PBX4_MOUSE Pre-B-cell leukemia transcription factor 4 OS=Mus musculus OX=10090 GN=Pbx4 PE=2 SV=2
9	AFDB:Q19503	0.344	0.442	3.651E-16	329	0.251	0.331	Q19503.pdb.gz	HM40_CAEEL Homeobox protein ceh-40 OS=Caenorhabditis elegans OX=6239 GN=ceh-40 PE=1 SV=1
10	AFDB:Q45EK2	0.357	0.415	2.696E-12	360	0.173	0.208	Q45EK2.pdb.gz	CEH60_CAEEL Homeobox protein ceh-60 OS=Caenorhabditis elegans OX=6239 GN=ceh-60 PE=1 SV=3
11	PDB:4egcA	0.108	0.087	2.524E-2	539	0.081	0.065	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:6ikoA	0.130	0.174	5.002E-1	303	0.085	0.122	6ikoA.pdb.gz
13	PDB:2hi3A	0.114	0.554	1.098	73	0.028	0.164	2hi3A.pdb.gz
14	PDB:4ke2A	0.118	0.250	1.354	196	0.076	0.168	4ke2A.pdb.gz
15	PDB:6v4uB	0.131	0.134	1.759	421	0.065	0.067	6v4uB.pdb.gz
16	PDB:7zs9M	0.078	0.098	1.953	310	0.067	0.094	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
17	PDB:7vvuV	0.142	0.387	2.169	113	0.044	0.168	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
18	PDB:1kmiZ	0.127	0.238	2.409	177	0.041	0.102	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
19	PDB:7nsuD	0.137	0.141	2.409	420	0.044	0.045	7nsuD.pdb.gz
20	PDB:7ax3A	0.113	0.089	2.675	587	0.078	0.058	7ax3A.pdb.gz	CryoEM structure of the super-constricted two-start dynamin 1 filament.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZR45	0.0	686	430	0.832	0.840	A0A8I5ZR45_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=1
2	B1WC30	0.0	532	347	0.645	0.807	B1WC30_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=1
3	F7EV88	0.0	623	406	0.763	0.815	F7EV88_RAT PBX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Pbx1 PE=3 SV=2
4	O35317	0.0	907	434	0.998	0.998	PBX3_MOUSE Pre-B-cell leukemia transcription factor 3 OS=Mus musculus OX=10090 GN=Pbx3 PE=1 SV=1
5	O35984	0.0	617	430	0.735	0.742	PBX2_MOUSE Pre-B-cell leukemia transcription factor 2 OS=Mus musculus OX=10090 GN=Pbx2 PE=1 SV=1
6	P40424	0.0	686	430	0.832	0.840	PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=1 SV=1
7	P40425	0.0	600	430	0.730	0.737	PBX2_HUMAN Pre-B-cell leukemia transcription factor 2 OS=Homo sapiens OX=9606 GN=PBX2 PE=1 SV=2
8	P40426	0.0	909	434	1.000	1.000	PBX3_HUMAN Pre-B-cell leukemia transcription factor 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
9	P41778	0.0	686	430	0.832	0.840	PBX1_MOUSE Pre-B-cell leukemia transcription factor 1 OS=Mus musculus OX=10090 GN=Pbx1 PE=1 SV=2
10	Q53YC7	0.0	532	347	0.645	0.807	Q53YC7_HUMAN Pre-B-cell leukemia transcription factor 1 OS=Homo sapiens OX=9606 GN=PBX1 PE=2 SV=1
11	Q5JS98	0.0	897	455	1.000	0.954	Q5JS98_HUMAN PBX homeobox 3 OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=1
12	Q8QGC4	0.0	533	347	0.650	0.813	PBX1_XENLA Pre-B-cell leukemia transcription factor 1 OS=Xenopus laevis OX=8355 GN=pbx1 PE=1 SV=1
13	Q96AL5	0.0	709	367	0.797	0.943	Q96AL5_HUMAN PBX3 protein (Fragment) OS=Homo sapiens OX=9606 GN=PBX3 PE=1 SV=2
14	Q9I9B6	0.0	541	346	0.657	0.824	Q9I9B6_DANRE Pbx1b homeodomain protein OS=Danio rerio OX=7955 GN=pbx1b PE=2 SV=1
15	Q9I9B7	0.0	702	428	0.834	0.846	Q9I9B7_DANRE Pbx1a homeodomain protein OS=Danio rerio OX=7955 GN=fi29e01 PE=2 SV=1
16	Q9PW77	0.0	518	343	0.636	0.805	Q9PW77_DANRE Pbx4 homeodomain protein OS=Danio rerio OX=7955 GN=fb77e11 PE=1 SV=1
17	Q9I9B4	1.84e-174	495	403	0.615	0.663	Q9I9B4_DANRE Pbxy homeodomain protein OS=Danio rerio OX=7955 GN=pbxy PE=1 SV=1
18	Q9BYU1	5.81e-172	488	374	0.594	0.690	PBX4_HUMAN Pre-B-cell leukemia transcription factor 4 OS=Homo sapiens OX=9606 GN=PBX4 PE=1 SV=2
19	P40427	8.55e-169	480	376	0.592	0.684	EXD_DROME Homeobox protein extradenticle OS=Drosophila melanogaster OX=7227 GN=exd PE=1 SV=1
20	Q99NE9	7.60e-158	452	378	0.516	0.593	PBX4_MOUSE Pre-B-cell leukemia transcription factor 4 OS=Mus musculus OX=10090 GN=Pbx4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	4.3e-12	57.1	Homeobox KN domain
2	PF00046 Homeodomain	9.9e-16	68.7	Homeodomain
3	PF18517 LZ3wCH	71	14.9	Leucine zipper with capping helix domain
4	PF03792 PBC	7.7e-83	288.2	PBC domain
5	PF04091 Sec15	1.2e+02	13.5	Exocyst complex subunit Sec15-like
6	PF19088 TUTase	28	15.5	TUTase nucleotidyltransferase domain
7	PF15943 YdaS_antitoxin	59	15.1	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008823089.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008839728.1	0.867	Homeobox A5
2	1026970.XP_008823517.1	0.841	Homeobox protein Meis2 isoform X1
3	1026970.XP_008839731.1	0.837	Homeobox protein Hox-A9
4	1026970.XP_008836502.1	0.833	Homeobox protein Hox-B1
5	1026970.XP_008836510.1	0.796	Homeobox protein Hox-B7
6	1026970.XP_008839721.1	0.790	Homeobox protein Hox-A1 isoform X1
7	1026970.XP_008825594.1	0.755	PBX/knotted 1 homeobox 1
8	1026970.XP_008837177.1	0.709	Homeobox protein Hox-C9
9	1026970.XP_008853532.1	0.709	Homeobox protein Hox-D9
10	1026970.XP_008832047.1	0.702	Meis homeobox 1
11	1026970.XP_008848976.1	0.659	T-cell leukemia homeobox protein 3
12	1026970.XP_008820352.1	0.657	Meis homeobox 3
13	1026970.XP_008838578.1	0.646	Fibulin 7
14	1026970.XP_008830164.1	0.612	Homeobox protein Nkx-2.3
15	1026970.XP_008836511.1	0.602	Homeobox protein Hox-B8
16	1026970.XP_008819688.1	0.600	1-acylglycerol-3-phosphate O-acyltransferase 1
17	1026970.XP_008833178.1	0.599	Homeobox protein PKNOX2
18	1026970.XP_008836506.1	0.596	Homeobox B4
19	1026970.XP_008837231.1	0.596	Homeobox C4
20	1026970.XP_008853487.1	0.593	Distal-less homeobox 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0140110	0.997	transcription regulator activity
GO:0003700	0.994	DNA-binding transcription factor activity
GO:0000977	0.991	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.982	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.976	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.958	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.948	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048856	0.991	anatomical structure development
GO:0050794	0.982	regulation of cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0048518	0.967	positive regulation of biological process
GO:0032501	0.965	multicellular organismal process
GO:0048731	0.949	system development
GO:0009893	0.931	positive regulation of metabolic process
GO:0051173	0.905	positive regulation of nitrogen compound metabolic process
GO:0010604	0.904	positive regulation of macromolecule metabolic process
GO:0048522	0.895	positive regulation of cellular process
GO:0031328	0.878	positive regulation of cellular biosynthetic process
GO:1903508	0.865	positive regulation of nucleic acid-templated transcription
GO:0045893	0.861	positive regulation of DNA-templated transcription
GO:0006357	0.792	regulation of transcription by RNA polymerase II
GO:0009987	0.745	cellular process
GO:0048513	0.556	animal organ development
GO:0003002	0.506	regionalization
GO:0045944	0.498	positive regulation of transcription by RNA polymerase II
GO:0009653	0.437	anatomical structure morphogenesis
GO:0030154	0.369	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.968	protein-containing complex
GO:0070013	0.965	intracellular organelle lumen
GO:0031981	0.954	nuclear lumen
GO:0005667	0.943	transcription regulator complex
GO:0005654	0.941	nucleoplasm
GO:0005737	0.616	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]