StarFunc result for job id P40763

User Input

>input (770 residues)
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C0SPC7	0.934	0.892	0.000	806	0.884	0.845	C0SPC7.pdb.gz
2	AFDB:P40763	1.000	1.000	0.000	770	1.000	1.000	P40763.pdb.gz	STAT3_HUMAN Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2
3	AFDB:O13133	0.937	0.941	6.254E-103	767	0.855	0.858	O13133.pdb.gz	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1
4	AFDB:A0A669KB53	0.886	0.863	1.055E-76	791	0.510	0.497	A0A669KB53.pdb.gz	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
5	AFDB:B5X3E8	0.881	0.881	2.898E-74	770	0.500	0.500	B5X3E8.pdb.gz	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
6	AFDB:A0A2R8Q947	0.768	0.797	7.251E-71	741	0.468	0.486	A0A2R8Q947.pdb.gz
7	AFDB:P42228	0.763	0.784	1.513E-69	749	0.458	0.471	P42228.pdb.gz	STAT4_MOUSE Signal transducer and activator of transcription 4 OS=Mus musculus OX=10090 GN=Stat4 PE=1 SV=1
8	AFDB:B0S789	0.880	0.933	6.302E-69	725	0.447	0.474	B0S789.pdb.gz	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
9	AFDB:X2KK07	0.858	0.814	3.156E-68	813	0.439	0.416	X2KK07.pdb.gz	X2KK07_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 PE=2 SV=1
10	PDB:1yvlB	0.798	0.935	4.405E-66	653	0.473	0.557	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
11	AFDB:Q8AW24	0.807	0.942	3.959E-65	657	0.445	0.522	Q8AW24.pdb.gz
12	PDB:6wczA	0.419	0.885	3.814E-20	350	0.183	0.403	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
13	PDB:7mjpA	0.099	0.185	6.208E-3	366	0.027	0.057	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
14	PDB:4lmhD	0.090	0.099	1.559E-2	695	0.060	0.066	4lmhD.pdb.gz	Insights into electron transfer at the microbe-mineral interface: the X-ray crystal structures of Shewanella oneidensis MtrC and OmcA
15	PDB:3oaiA	0.098	0.142	3.409E-2	488	0.021	0.033	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
16	PDB:4n6rB	0.124	0.406	4.493E-2	198	0.027	0.106	4n6rB.pdb.gz
17	PDB:1cqxA	0.072	0.113	1.181E-1	403	0.044	0.084	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
18	PDB:7tysA	0.089	0.147	1.237E-1	361	0.032	0.069	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
19	PDB:6zgaB	0.079	0.078	1.356E-1	786	0.031	0.031	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
20	PDB:6wvdA	0.072	0.124	1.787E-1	397	0.040	0.078	6wvdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0D9RIE1	786	750	0.508	0.521	A0A0D9RIE1_CHLSB Signal transducer and activator of transcription OS=Chlorocebus sabaeus OX=60711 GN=STAT1 PE=3 SV=1
2	A0A0G2JX93	674	1205	0.469	0.300	A0A0G2JX93_RAT Signal transducer and activator of transcription 1 OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=2
3	A0A0G2JXH1	686	704	0.453	0.496	A0A0G2JXH1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
4	A0A0R4IGF2	1351	738	0.844	0.881	A0A0R4IGF2_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=z-Stat3 PE=1 SV=2
5	A0A669KB53	787	791	0.509	0.496	A0A669KB53_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
6	A0A669KB56	788	748	0.514	0.529	A0A669KB56_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
7	A0A669KB68	782	748	0.508	0.523	A0A669KB68_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
8	A0A669KBA4	788	779	0.517	0.511	A0A669KBA4_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
9	A7LH49	749	739	0.499	0.520	A7LH49_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=LOC100136558 PE=2 SV=1
10	B0JYL6	794	747	0.505	0.521	B0JYL6_BOVIN Signal transducer and activator of transcription OS=Bos taurus OX=9913 GN=STAT1 PE=1 SV=1
11	B0S789	696	725	0.449	0.477	B0S789_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
12	B0S790	701	731	0.470	0.495	B0S790_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=STAT PE=3 SV=1
13	B5X3E8	757	770	0.501	0.501	B5X3E8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1 PE=2 SV=1
14	B9UYM8	580	802	0.422	0.405	B9UYM8_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT2 PE=2 SV=1
15	C7EY83	756	757	0.501	0.510	C7EY83_SALSA Signal transducer and activator of transcription OS=Salmo salar OX=8030 GN=STAT1a PE=2 SV=1
16	F1M9D6	790	755	0.518	0.528	F1M9D6_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat1 PE=1 SV=3
17	F7FAC1	689	749	0.461	0.474	F7FAC1_RAT Signal transducer and activator of transcription OS=Rattus norvegicus OX=10116 GN=Stat4 PE=1 SV=1
18	G8JLH9	1404	672	0.873	1.000	G8JLH9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=1
19	J3KPM9	780	714	0.499	0.538	J3KPM9_HUMAN Signal transducer and activator of transcription OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=1
20	O13133	1352	767	0.858	0.862	O13133_ONCMY Signal transducer and activator of transcription OS=Oncorhynchus mykiss OX=8022 GN=rbtStat3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11570 E2R135	3.6e+02	12.9	Coiled-coil receptor-binding R-domain of colicin E2
2	PF00017 SH2	1.7e-10	52.1	SH2 domain
3	PF01017 STAT_alpha	2.7e-53	191.9	STAT protein, all-alpha domain
4	PF02864 STAT_bind	5.6e-36	135.5	STAT protein, DNA binding domain
5	PF02865 STAT_int	6.6e-36	134.7	STAT protein, protein interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 109478.XP_005875791.1

Rank	PPI partner	STRING score	Description
1	109478.XP_005861388.1	0.999	Tyrosine-protein kinase JAK2 isoform X1
2	109478.XP_005868086.1	0.996	Tyrosine-protein kinase
3	109478.XP_005858480.1	0.995	Epidermal growth factor receptor-like
4	109478.XP_005871433.1	0.995	Histone acetyltransferase p300
5	109478.XP_005873939.1	0.993	Tyrosine-protein kinase JAK3 isoform X1
6	109478.XP_005885016.1	0.991	E3 SUMO-protein ligase PIAS3
7	109478.XP_005872509.1	0.988	Signal transducer and activator of transcription 1-like isoform X1
8	109478.XP_005868514.1	0.987	Proto-oncogene tyrosine-protein kinase Src isoform X1
9	109478.XP_005859231.1	0.982	Non-receptor tyrosine-protein kinase TYK2 isoform X1
10	109478.XP_005866976.1	0.981	Tyrosine-protein phosphatase non-receptor type 2 isoform X1
11	109478.XP_005867554.1	0.979	Interleukin-6 receptor subunit alpha
12	109478.XP_005862824.1	0.976	Forkhead box protein O1-like
13	109478.XP_005874107.1	0.974	Hypoxia-inducible factor 1-alpha
14	109478.XP_005874216.1	0.974	Interleukin 6 signal transducer
15	109478.XP_005873494.1	0.968	Belongs to the PI3/PI4-kinase family.
16	109478.XP_005878413.1	0.968	Histone deacetylase 1
17	109478.XP_005862311.1	0.965	snRNA-activating protein complex subunit 3
18	109478.XP_005868103.1	0.965	Interleukin-23 receptor
19	109478.XP_005884380.1	0.963	Suppressor of cytokine signaling 3
20	109478.XP_005859652.1	0.962	Interferon regulatory factor 9 isoform X2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0019899	1.000	enzyme binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0140297	0.997	DNA-binding transcription factor binding
GO:0042802	0.995	identical protein binding
GO:0061629	0.987	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0005102	0.974	signaling receptor binding
GO:1990837	0.969	sequence-specific double-stranded DNA binding
GO:0000981	0.956	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.926	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.896	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019900	0.794	kinase binding
GO:0019903	0.786	protein phosphatase binding
GO:0019901	0.396	protein kinase binding
GO:0046983	0.336	protein dimerization activity
GO:0038023	0.329	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.988	signal transduction
GO:0048522	0.976	positive regulation of cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0009893	0.969	positive regulation of metabolic process
GO:0007166	0.966	cell surface receptor signaling pathway
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0031323	0.946	regulation of cellular metabolic process
GO:0007259	0.945	receptor signaling pathway via JAK-STAT
GO:0051239	0.944	regulation of multicellular organismal process
GO:0010604	0.930	positive regulation of macromolecule metabolic process
GO:0032501	0.926	multicellular organismal process
GO:0042221	0.925	response to chemical
GO:0080090	0.921	regulation of primary metabolic process
GO:0032502	0.920	developmental process
GO:0051171	0.917	regulation of nitrogen compound metabolic process
GO:0009889	0.917	regulation of biosynthetic process
GO:0048856	0.902	anatomical structure development
GO:0042127	0.902	regulation of cell population proliferation
GO:0048523	0.902	negative regulation of cellular process
GO:0010556	0.892	regulation of macromolecule biosynthetic process
GO:0010468	0.889	regulation of gene expression
GO:0008284	0.888	positive regulation of cell population proliferation
GO:0051240	0.865	positive regulation of multicellular organismal process
GO:0070887	0.857	cellular response to chemical stimulus
GO:0010033	0.845	response to organic substance
GO:0071310	0.830	cellular response to organic substance
GO:0019219	0.819	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.816	multicellular organism development
GO:0030154	0.786	cell differentiation
GO:0051173	0.757	positive regulation of nitrogen compound metabolic process
GO:0031325	0.741	positive regulation of cellular metabolic process
GO:0050793	0.719	regulation of developmental process
GO:0010628	0.707	positive regulation of gene expression
GO:0045893	0.695	positive regulation of DNA-templated transcription
GO:0048731	0.673	system development
GO:0065008	0.666	regulation of biological quality
GO:0045944	0.659	positive regulation of transcription by RNA polymerase II
GO:0051094	0.655	positive regulation of developmental process
GO:2000026	0.653	regulation of multicellular organismal development
GO:0048513	0.646	animal organ development
GO:0045597	0.622	positive regulation of cell differentiation
GO:0009719	0.620	response to endogenous stimulus
GO:0043434	0.598	response to peptide hormone
GO:0060284	0.576	regulation of cell development
GO:0034097	0.559	response to cytokine
GO:0009605	0.542	response to external stimulus
GO:0071704	0.529	organic substance metabolic process
GO:0044238	0.522	primary metabolic process
GO:0048583	0.507	regulation of response to stimulus
GO:0044237	0.491	cellular metabolic process
GO:0006807	0.453	nitrogen compound metabolic process
GO:0009892	0.438	negative regulation of metabolic process
GO:0043170	0.396	macromolecule metabolic process
GO:0065009	0.395	regulation of molecular function
GO:0023051	0.389	regulation of signaling
GO:0010646	0.383	regulation of cell communication
GO:0071345	0.383	cellular response to cytokine stimulus
GO:0006950	0.382	response to stress
GO:0009966	0.312	regulation of signal transduction
GO:0002376	0.308	immune system process
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0016020	0.856	membrane
GO:0032991	0.325	protein-containing complex
GO:0043228	0.320	non-membrane-bounded organelle
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]