StarFunc result for job id P40818

User Input

>input (1118 residues)
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEK
GAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLP
DDSKDTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQTPPASIEVDE
NIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSIKNVPQIDRTKKPAVKLPEE
HRIKSESTNHEQQSPQSGKVIPDRSTKPVVFSPTLMLTDEEKARIHAETALLMEKNKQEK
ELRERQQEEQKEKLRKEEQEQKAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKET
SAKRGKEITGVKRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSG
KPFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGLPSGWAKFLD
PITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSP
DITQAIQEEEKRKPTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLR
NLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTG
QYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDH
LDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTS
KCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRW
KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRW
FKFDDHEVSDISVSSVKSSAAYILFYTSLGPRVTDVAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZN39	0.344	0.353	0.000	1081	0.811	0.839	D3ZN39.pdb.gz	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
2	AFDB:P40818	1.000	1.000	0.000	1118	1.000	1.000	P40818.pdb.gz	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
3	AFDB:Q8MQX4	0.297	0.367	4.323E-65	896	0.279	0.348	Q8MQX4.pdb.gz	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
4	AFDB:Q9R085	0.297	0.348	9.519E-39	952	0.149	0.175	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
5	AFDB:P51784	0.302	0.350	9.688E-38	963	0.147	0.170	P51784.pdb.gz	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
6	AFDB:A1LPW7	0.294	0.341	2.345E-37	963	0.149	0.173	A1LPW7.pdb.gz
7	AFDB:Q5D006	0.292	0.353	1.452E-36	921	0.144	0.175	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
8	AFDB:A0A024R2X6	0.295	0.360	2.386E-36	916	0.141	0.172	A0A024R2X6.pdb.gz
9	AFDB:Q9QZL6	0.283	0.546	1.775E-34	566	0.138	0.272	Q9QZL6.pdb.gz	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1
10	PDB:5cvnB	0.237	0.775	1.307E-26	321	0.089	0.308	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
11	PDB:3mhsA	0.236	0.550	4.657E-26	455	0.090	0.222	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	AFDB:Q8NFA0	0.299	0.209	6.277E-25	1604	0.158	0.110	Q8NFA0.pdb.gz	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
13	PDB:5k16B	0.240	0.754	3.867E-24	328	0.089	0.302	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:4fjcE	0.215	0.516	2.306E-22	434	0.088	0.226	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	PDB:7yxxA	0.233	0.152	2.220E-21	1754	0.084	0.054	7yxxA.pdb.gz
16	PDB:7ay1D	0.236	0.710	4.309E-21	341	0.079	0.258	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
17	PDB:8a9kD	0.202	0.716	8.835E-21	285	0.072	0.281	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
18	PDB:5k1bA	0.211	0.854	4.385E-20	264	0.088	0.371	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
19	PDB:4wa6D	0.220	0.561	7.619E-20	415	0.078	0.210	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
20	PDB:3ihpB	0.230	0.367	3.578E-19	681	0.080	0.131	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A1E0	0.0	1723	1026	0.763	0.831	A0A8I6A1E0_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=1
2	D3ZN39	0.0	1827	1081	0.815	0.843	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
3	P40818	0.0	2321	1118	1.000	1.000	UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1
4	Q80U87	0.0	1811	1080	0.817	0.845	UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2
5	Q9VDD8	1.03e-92	319	896	0.156	0.194	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
6	Q8MQX4	2.28e-92	318	896	0.155	0.193	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
7	H1UUC2	4.72e-92	301	367	0.145	0.441	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
8	O57429	3.40e-81	271	357	0.131	0.409	UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1
9	Q6P8X6	1.06e-78	265	390	0.121	0.346	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
10	O75604	5.17e-75	262	605	0.129	0.238	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
11	Q5U349	1.98e-74	261	618	0.131	0.236	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
12	O88623	2.41e-74	261	619	0.131	0.236	UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=3
13	X2JLM6	5.55e-65	233	565	0.111	0.219	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
14	X2JG37	3.20e-64	238	950	0.112	0.132	X2JG37_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
15	Q8IQ27	3.61e-64	238	938	0.112	0.133	UBP2_DROME Ubiquitin carboxyl-terminal hydrolase Usp2 OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=1 SV=1
16	Q70EL3	1.01e-62	219	339	0.106	0.348	UBP50_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 50 OS=Homo sapiens OX=9606 GN=USP50 PE=2 SV=1
17	Q9UK80	1.79e-60	219	565	0.112	0.221	UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens OX=9606 GN=USP21 PE=1 SV=1
18	B2GUX4	3.57e-60	219	565	0.111	0.219	UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus OX=10116 GN=Usp21 PE=2 SV=1
19	A0A1D8PFU3	3.89e-60	224	811	0.128	0.176	A0A1D8PFU3_CANAL Ubiquitin carboxyl-terminal hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DOA4 PE=3 SV=1
20	Q9QZL6	1.07e-59	217	566	0.112	0.221	UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus OX=10090 GN=Usp21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18256 HscB_4_cys	6.9e+02	11.5	Co-chaperone HscB tetracysteine metal binding motif
2	PF02069 Metallothio_Pro	3.6e+02	12.8	Prokaryotic metallothionein
3	PF00581 Rhodanese	0.0057	28.5	Rhodanese-like domain
4	PF00443 UCH	1.2e-84	295.8	Ubiquitin carboxyl-terminal hydrolase
5	PF13423 UCH_1	1.6e-12	59.3	Ubiquitin carboxyl-terminal hydrolase
6	PF08969 USP8_dimer	1.5e-29	113.8	USP8 dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342755	0.999	E3 ubiquitin-protein ligase NRDP1
2	9606.ENSP00000263904	0.998	Signal transducing adapter molecule 2
3	9606.ENSP00000275493	0.993	Epidermal growth factor receptor
4	9606.ENSP00000366746	0.977	Signal transducing adapter molecule 1
5	9606.ENSP00000441543	0.976	Polyubiquitin-C
6	9606.ENSP00000379287	0.963	14-3-3 protein zeta/delta
7	9606.ENSP00000273261	0.958	Leucine-rich repeats and immunoglobulin-like domains protein 1
8	9606.ENSP00000339186	0.948	GRB2-related adapter protein 2
9	9606.ENSP00000451828	0.943	RAC-alpha serine/threonine-protein kinase
10	9606.ENSP00000331201	0.940	Hepatocyte growth factor-regulated tyrosine kinase substrate
11	9606.ENSP00000444357	0.935	Ubiquitin thioesterase OTUB1
12	9606.ENSP00000265171	0.924	Pro-epidermal growth factor
13	9606.ENSP00000434034	0.919	Frizzled-4
14	9606.ENSP00000354607	0.918	Frizzled-5
15	9606.ENSP00000351605	0.916	Frizzled-6
16	9606.ENSP00000363826	0.916	Frizzled-8
17	9606.ENSP00000317272	0.913	Hepatocyte growth factor receptor
18	9606.ENSP00000255499	0.911	E3 ubiquitin-protein ligase RNF128
19	9606.ENSP00000261349	0.907	Low-density lipoprotein receptor-related protein 6
20	9606.ENSP00000264335	0.906	14-3-3 protein epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0045296	0.996	cadherin binding
GO:0004197	0.996	cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0019538	0.991	protein metabolic process
GO:0009987	0.989	cellular process
GO:0006508	0.956	proteolysis
GO:0070647	0.956	protein modification by small protein conjugation or removal
GO:0016579	0.947	protein deubiquitination
GO:0019222	0.946	regulation of metabolic process
GO:0060255	0.926	regulation of macromolecule metabolic process
GO:0080090	0.893	regulation of primary metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0051246	0.852	regulation of protein metabolic process
GO:0048519	0.846	negative regulation of biological process
GO:0023051	0.845	regulation of signaling
GO:0010646	0.845	regulation of cell communication
GO:0050896	0.834	response to stimulus
GO:0071840	0.802	cellular component organization or biogenesis
GO:0016043	0.791	cellular component organization
GO:0048518	0.784	positive regulation of biological process
GO:0009894	0.713	regulation of catabolic process
GO:0048522	0.697	positive regulation of cellular process
GO:0048583	0.672	regulation of response to stimulus
GO:0051716	0.651	cellular response to stimulus
GO:0009893	0.594	positive regulation of metabolic process
GO:0010604	0.579	positive regulation of macromolecule metabolic process
GO:0009966	0.568	regulation of signal transduction
GO:0006996	0.511	organelle organization
GO:0048523	0.501	negative regulation of cellular process
GO:0044237	0.499	cellular metabolic process
GO:0051128	0.472	regulation of cellular component organization
GO:0009892	0.469	negative regulation of metabolic process
GO:0051173	0.431	positive regulation of nitrogen compound metabolic process
GO:0031323	0.387	regulation of cellular metabolic process
GO:0051172	0.380	negative regulation of nitrogen compound metabolic process
GO:0007165	0.360	signal transduction
GO:0032879	0.356	regulation of localization
GO:0010605	0.351	negative regulation of macromolecule metabolic process
GO:0016050	0.300	vesicle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0005768	0.998	endosome
GO:0005886	0.988	plasma membrane
GO:0005769	0.950	early endosome
GO:0030496	0.940	midbody
GO:0070013	0.915	intracellular organelle lumen
GO:0005634	0.856	nucleus
GO:0019898	0.836	extrinsic component of membrane
GO:0031090	0.722	organelle membrane
GO:0070062	0.693	extracellular exosome
GO:0012506	0.463	vesicle membrane
GO:0030659	0.448	cytoplasmic vesicle membrane
GO:0031981	0.383	nuclear lumen
GO:0098588	0.372	bounding membrane of organelle
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.996	Cysteine endopeptidases.

[back to server]