StarFunc result for job id P40925

User Input

>input (334 residues)
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88989	1.000	1.000	8.278E-65	334	0.970	0.970	O88989.pdb.gz	MDHC_RAT Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mdh1 PE=1 SV=3
2	PDB:4mdhA	0.975	0.975	1.393E-56	334	0.952	0.952	4mdhA.pdb.gz	Refined crystal structure of cytoplasmic malate dehydrogenase at 2.5-A resolution.
3	AFDB:Q8MQS7	0.987	0.978	5.647E-52	337	0.659	0.653	Q8MQS7.pdb.gz	Q8MQS7_DROME Malate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Mdh1 PE=2 SV=1
4	AFDB:Q9UAV5	0.989	0.984	1.169E-49	336	0.602	0.598	Q9UAV5.pdb.gz	MDHC_CAEEL Malate dehydrogenase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=mdh-1 PE=1 SV=1
5	AFDB:F1C7I4	0.982	0.988	1.879E-48	332	0.578	0.581	F1C7I4.pdb.gz	MDHC_TAESO Malate dehydrogenase, cytoplasmic OS=Taenia solium OX=6204 GN=MDH PE=1 SV=1
6	AFDB:P57106	0.972	0.978	2.346E-48	332	0.602	0.605	P57106.pdb.gz	MDHC2_ARATH Malate dehydrogenase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH2 PE=1 SV=1
7	AFDB:Q9FJU0	0.976	0.961	1.242E-47	339	0.569	0.560	Q9FJU0.pdb.gz	MDHC3_ARATH Malate dehydrogenase 3, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH3 PE=2 SV=1
8	PDB:5nueB	0.959	0.964	1.935E-47	332	0.608	0.611	5nueB.pdb.gz	Self-protection of cytosolic malate dehydrogenase against oxidative stress in Arabidopsis.
9	AFDB:Q383F3	0.960	0.977	1.438E-44	328	0.485	0.494	Q383F3.pdb.gz	Q383F3_TRYB2 Malate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3040 PE=3 SV=1
10	AFDB:P9WK13	0.953	0.967	4.259E-43	329	0.506	0.514	P9WK13.pdb.gz	MDH_MYCTU Malate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mdh PE=1 SV=1
11	AFDB:Q54D04	0.948	0.910	6.128E-42	348	0.503	0.483	Q54D04.pdb.gz	MDHB_DICDI Probable malate dehydrogenase 2, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mdhB PE=1 SV=1
12	AFDB:Q4Q7X6	0.945	0.973	2.457E-41	324	0.476	0.491	Q4Q7X6.pdb.gz	Q4Q7X6_LEIMA Malate dehydrogenase OS=Leishmania major OX=5664 GN=cMDH PE=1 SV=1
13	PDB:4tvoA	0.939	0.956	5.054E-41	328	0.506	0.515	4tvoA.pdb.gz
14	PDB:4i1iA	0.918	0.957	5.343E-41	320	0.473	0.494	4i1iA.pdb.gz	Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin in complex with NAD
15	PDB:5nfrA	0.811	0.862	9.518E-22	313	0.249	0.265	5nfrA.pdb.gz
16	PDB:7dbjA	0.809	0.811	4.791E-19	333	0.201	0.201	7dbjA.pdb.gz	Identification of the first highly selective inhibitor of human lactate dehydrogenase B.
17	PDB:4qsmA	0.814	0.818	1.719E-18	332	0.192	0.193	4qsmA.pdb.gz	Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
18	PDB:1oc4A	0.809	0.855	1.980E-17	315	0.210	0.222	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
19	PDB:7epmA	0.816	0.814	3.648E-17	335	0.213	0.212	7epmA.pdb.gz	Identification of human LDHC4 as a potential target for anticancer drug discovery.
20	PDB:1ldbA	0.752	0.846	9.915E-17	294	0.183	0.207	1ldbA.pdb.gz	Structure determination and refinement of Bacillus stearothermophilus lactate dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW95	0.0	684	353	1.000	0.946	A0A5K1VW95_HUMAN Malate dehydrogenase OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=1
2	O88989	0.0	671	334	0.970	0.970	MDHC_RAT Malate dehydrogenase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Mdh1 PE=1 SV=3
3	P11708	0.0	662	334	0.955	0.955	MDHC_PIG Malate dehydrogenase, cytoplasmic OS=Sus scrofa OX=9823 GN=MDH1 PE=1 SV=4
4	P14152	0.0	669	334	0.964	0.964	MDHC_MOUSE Malate dehydrogenase, cytoplasmic OS=Mus musculus OX=10090 GN=Mdh1 PE=1 SV=3
5	P40925	0.0	684	334	1.000	1.000	MDHC_HUMAN Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4
6	Q5ZME2	0.0	617	334	0.904	0.904	MDHC_CHICK Malate dehydrogenase, cytoplasmic OS=Gallus gallus OX=9031 GN=MDH1 PE=2 SV=1
7	V9HWF2	0.0	684	334	1.000	1.000	V9HWF2_HUMAN Malate dehydrogenase OS=Homo sapiens OX=9606 GN=HEL-S-32 PE=2 SV=1
8	Q9VKX2	2.46e-152	432	337	0.662	0.656	Q9VKX2_DROME Malate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Mdh1 PE=1 SV=2
9	Q8MQS7	1.37e-151	431	337	0.659	0.653	Q8MQS7_DROME Malate dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Mdh1 PE=2 SV=1
10	C9JF79	1.30e-146	414	222	0.608	0.914	C9JF79_HUMAN Malate dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=1
11	P93819	8.89e-141	403	332	0.611	0.614	MDHC1_ARATH Malate dehydrogenase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH1 PE=1 SV=2
12	P57106	1.93e-137	395	332	0.605	0.608	MDHC2_ARATH Malate dehydrogenase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH2 PE=1 SV=1
13	Q9UAV5	1.85e-136	392	336	0.599	0.595	MDHC_CAEEL Malate dehydrogenase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=mdh-1 PE=1 SV=1
14	F1C7I4	1.74e-130	377	332	0.578	0.581	MDHC_TAESO Malate dehydrogenase, cytoplasmic OS=Taenia solium OX=6204 GN=MDH PE=1 SV=1
15	Q9FJU0	4.00e-130	376	339	0.569	0.560	MDHC3_ARATH Malate dehydrogenase 3, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=MDH3 PE=2 SV=1
16	P9WK13	1.41e-109	324	329	0.512	0.520	MDH_MYCTU Malate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mdh PE=1 SV=1
17	Q54D04	1.83e-107	319	348	0.509	0.489	MDHB_DICDI Probable malate dehydrogenase 2, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=mdhB PE=1 SV=1
18	Q95WV4	6.25e-101	302	328	0.473	0.482	Q95WV4_9TRYP Malate dehydrogenase OS=Trypanosoma brucei OX=5691 PE=3 SV=1
19	Q383F3	5.22e-100	300	328	0.470	0.479	Q383F3_TRYB2 Malate dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3040 PE=3 SV=1
20	Q4Q7X6	1.84e-92	280	324	0.476	0.491	Q4Q7X6_LEIMA Malate dehydrogenase OS=Leishmania major OX=5664 GN=cMDH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10517 DM13	4e+02	13.0	Electron transfer DM13
2	PF01915 Glyco_hydro_3_C	2.5e+02	13.0	Glycosyl hydrolase family 3 C-terminal domain
3	PF02866 Ldh_1_C	7.1e-43	158.0	lactate/malate dehydrogenase, alpha/beta C-terminal domain
4	PF00056 Ldh_1_N	3.3e-36	135.9	lactate/malate dehydrogenase, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000020567

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000003656	0.997	Uncharacterized protein
2	9598.ENSPTRP00000004968	0.997	Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H(2)S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). [...]
3	9598.ENSPTRP00000013976	0.995	Aspartate aminotransferase
4	9598.ENSPTRP00000033039	0.995	Malate dehydrogenase
5	9598.ENSPTRP00000045149	0.994	Pyruvate carboxylase
6	9598.ENSPTRP00000023500	0.992	Uncharacterized protein
7	9598.ENSPTRP00000044752	0.984	Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis
8	9598.ENSPTRP00000010507	0.981	Uncharacterized protein
9	9598.ENSPTRP00000031411	0.976	Malic enzyme
10	9598.ENSPTRP00000007130	0.974	Malic enzyme
11	9598.ENSPTRP00000017045	0.965	Malic enzyme
12	9598.ENSPTRP00000008664	0.964	Uncharacterized protein
13	9598.ENSPTRP00000023837	0.907	Superoxide dismutase [Cu-Zn]
14	9598.ENSPTRP00000001415	0.904	Uncharacterized protein
15	9598.ENSPTRP00000004734	0.894	Important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission
16	9598.ENSPTRP00000024821	0.870	Adenylosuccinate lyase
17	9598.ENSPTRP00000000207	0.855	Alpha-enolase
18	9598.ENSPTRP00000054687	0.843	Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA)
19	9598.ENSPTRP00000035894	0.834	Phosphoglucomutase 5
20	9598.ENSPTRP00000026930	0.832	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030060	1.000	L-malate dehydrogenase activity
GO:0005488	0.999	binding
GO:0005515	0.869	protein binding
GO:0097159	0.827	organic cyclic compound binding
GO:1901363	0.820	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.993	small molecule metabolic process
GO:0055086	0.979	nucleobase-containing small molecule metabolic process
GO:0072521	0.977	purine-containing compound metabolic process
GO:0009117	0.973	nucleotide metabolic process
GO:0072524	0.965	pyridine-containing compound metabolic process
GO:0006163	0.957	purine nucleotide metabolic process
GO:0046496	0.952	nicotinamide nucleotide metabolic process
GO:0005975	0.848	carbohydrate metabolic process
GO:0005996	0.840	monosaccharide metabolic process
GO:0019318	0.832	hexose metabolic process
GO:0019674	0.824	NAD metabolic process
GO:0006006	0.821	glucose metabolic process
GO:0046364	0.797	monosaccharide biosynthetic process
GO:0006094	0.789	gluconeogenesis
GO:0019752	0.437	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043229	0.996	intracellular organelle
GO:0005576	0.967	extracellular region
GO:0043227	0.963	membrane-bounded organelle
GO:0043232	0.927	intracellular non-membrane-bounded organelle
GO:0005615	0.832	extracellular space
GO:0043231	0.807	intracellular membrane-bounded organelle
GO:0031982	0.774	vesicle
GO:1903561	0.696	extracellular vesicle
GO:0070062	0.690	extracellular exosome
GO:0070013	0.675	intracellular organelle lumen
GO:0005813	0.496	centrosome
GO:0005739	0.409	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21432	1.000	(S)-malate + NAD(+) = H(+) + NADH + oxaloacetate
EC:1.1.1.37	1.000	malate dehydrogenase.

[back to server]