StarFunc result for job id P40926

User Input

>input (338 residues)
MLSALARPASAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH
TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI
VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF
VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA
KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE
KNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVKTLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4K3	0.994	0.994	9.445E-66	338	1.000	1.000	A0A024R4K3.pdb.gz	A0A024R4K3_HUMAN Malate dehydrogenase OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:2dfdA	0.919	0.989	1.793E-58	314	0.929	1.000	2dfdA.pdb.gz	Crystal Structure of Human Malate Dehydrogenase Type 2
3	AFDB:B4FRJ1	0.929	0.923	5.276E-49	340	0.583	0.579	B4FRJ1.pdb.gz	B4FRJ1_MAIZE Malate dehydrogenase OS=Zea mays OX=4577 GN=100272900 PE=2 SV=1
4	AFDB:Q9LKA3	0.968	0.959	6.245E-49	341	0.544	0.540	Q9LKA3.pdb.gz	MDHM2_ARATH Malate dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g15020 PE=1 SV=1
5	AFDB:Q9ZP06	0.958	0.949	1.297E-48	341	0.565	0.560	Q9ZP06.pdb.gz	MDHM1_ARATH Malate dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g53240 PE=1 SV=1
6	AFDB:Q9VEB1	0.959	0.964	2.693E-48	336	0.589	0.592	Q9VEB1.pdb.gz	Q9VEB1_DROME Malate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mdh2 PE=1 SV=1
7	AFDB:Q9SN86	0.925	0.777	7.002E-48	403	0.565	0.474	Q9SN86.pdb.gz	MDHP_ARATH Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g47520 PE=1 SV=1
8	AFDB:O02640	0.919	0.911	9.832E-47	341	0.562	0.557	O02640.pdb.gz	MDHM_CAEEL Malate dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mdh-2 PE=1 SV=1
9	AFDB:O82399	0.927	0.885	3.582E-46	354	0.524	0.500	O82399.pdb.gz	MDHX1_ARATH Malate dehydrogenase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH1 PE=1 SV=1
10	AFDB:Q9ZP05	0.921	0.879	3.797E-45	354	0.530	0.506	Q9ZP05.pdb.gz	MDHX2_ARATH Malate dehydrogenase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH2 PE=1 SV=1
11	AFDB:C8V1V3	0.947	0.941	8.342E-45	340	0.553	0.550	C8V1V3.pdb.gz	C8V1V3_EMENI Malate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06717 PE=3 SV=1
12	PDB:1emdA	0.887	0.959	3.089E-40	312	0.536	0.580	1emdA.pdb.gz	Crystal structure of a ternary complex of Escherichia coli malate dehydrogenase citrate and NAD at 1.9 A resolution.
13	PDB:5zi2A	0.874	0.871	1.208E-32	339	0.426	0.425	5zi2A.pdb.gz	Structure of glyoxysomal malate dehydrogenase (MDH3) from Saccharomyces cerevisiae.
14	PDB:1oc4A	0.739	0.789	1.642E-20	315	0.237	0.254	1oc4A.pdb.gz	Crystal Structure of Plasmodium Berghei Lactate Dehydrogenase Indicates the Unique Structural Differences of These Enzymes are Shared Across the Plasmodium Genus
15	PDB:5nfrA	0.774	0.832	3.409E-20	313	0.231	0.249	5nfrA.pdb.gz
16	PDB:4qsmA	0.735	0.747	3.053E-19	332	0.198	0.202	4qsmA.pdb.gz	Structures of lactate dehydrogenase A (LDHA) in apo, ternary and inhibitor-bound forms.
17	PDB:7dbjA	0.747	0.758	2.585E-18	333	0.195	0.198	7dbjA.pdb.gz	Identification of the first highly selective inhibitor of human lactate dehydrogenase B.
18	PDB:5nueB	0.780	0.793	3.236E-18	332	0.228	0.232	5nueB.pdb.gz	Self-protection of cytosolic malate dehydrogenase against oxidative stress in Arabidopsis.
19	PDB:7epmA	0.757	0.763	3.423E-18	335	0.216	0.218	7epmA.pdb.gz	Identification of human LDHC4 as a potential target for anticancer drug discovery.
20	PDB:1ldnA	0.755	0.803	4.534E-18	316	0.219	0.234	1ldnA.pdb.gz	Structure of a ternary complex of an allosteric lactate dehydrogenase from Bacillus stearothermophilus at 2.5 A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R4K3	0.0	686	338	1.000	1.000	A0A024R4K3_HUMAN Malate dehydrogenase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P00346	0.0	655	338	0.941	0.941	MDHM_PIG Malate dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=MDH2 PE=1 SV=2
3	P04636	0.0	659	338	0.944	0.944	MDHM_RAT Malate dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mdh2 PE=1 SV=2
4	P08249	0.0	662	338	0.950	0.950	MDHM_MOUSE Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3
5	P40926	0.0	686	338	1.000	1.000	MDHM_HUMAN Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3
6	G3XAL0	1.63e-169	472	231	0.683	1.000	G3XAL0_HUMAN Malate dehydrogenase OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=1
7	Q9VEB1	1.19e-147	421	336	0.589	0.592	Q9VEB1_DROME Malate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mdh2 PE=1 SV=1
8	Q9ZP06	1.07e-132	383	341	0.565	0.560	MDHM1_ARATH Malate dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g53240 PE=1 SV=1
9	O02640	4.12e-132	382	341	0.559	0.554	MDHM_CAEEL Malate dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mdh-2 PE=1 SV=1
10	B4FRJ1	1.01e-131	380	340	0.586	0.582	B4FRJ1_MAIZE Malate dehydrogenase OS=Zea mays OX=4577 GN=100272900 PE=2 SV=1
11	Q9LKA3	3.54e-130	377	341	0.556	0.551	MDHM2_ARATH Malate dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g15020 PE=1 SV=1
12	Q9SN86	2.36e-126	369	403	0.556	0.467	MDHP_ARATH Malate dehydrogenase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g47520 PE=1 SV=1
13	O82399	9.01e-124	361	354	0.521	0.497	MDHX1_ARATH Malate dehydrogenase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH1 PE=1 SV=1
14	Q9ZP05	1.01e-119	351	354	0.530	0.506	MDHX2_ARATH Malate dehydrogenase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=PMDH2 PE=1 SV=1
15	C8V1V3	1.10e-118	347	340	0.562	0.559	C8V1V3_EMENI Malate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06717 PE=3 SV=1
16	Q5AMP4	1.12e-118	347	332	0.547	0.557	Q5AMP4_CANAL Malate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MDH1-1 PE=3 SV=1
17	P61889	1.19e-117	344	312	0.538	0.583	MDH_ECOLI Malate dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=mdh PE=1 SV=1
18	Q4Q3J2	2.28e-108	321	325	0.500	0.520	Q4Q3J2_LEIMA Malate dehydrogenase OS=Leishmania major OX=5664 GN=mMDH PE=3 SV=1
19	Q9Y7R8	4.38e-107	318	341	0.500	0.496	MDHM_SCHPO Malate dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=MDH1 PE=3 SV=1
20	B3H560	3.90e-106	317	363	0.485	0.452	B3H560_ARATH Malate dehydrogenase OS=Arabidopsis thaliana OX=3702 GN=PMDH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	8.8	16.8	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF01113 DapB_N	2.6e+02	13.1	Dihydrodipicolinate reductase, N-terminus
3	PF02866 Ldh_1_C	1.4e-53	192.8	lactate/malate dehydrogenase, alpha/beta C-terminal domain
4	PF00056 Ldh_1_N	1e-45	166.7	lactate/malate dehydrogenase, NAD binding domain
5	PF13460 NAD_binding_10	15	17.0	NAD(P)H-binding
6	PF01118 Semialdhyde_dh	0.55	22.1	Semialdehyde dehydrogenase, NAD binding domain
7	PF02882 THF_DHG_CYH_C	12	16.7	Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342056	0.999	Citrate synthase, mitochondrial
2	9606.ENSP00000355518	0.997	Fumarate hydratase, mitochondrial
3	9606.ENSP00000245206	0.996	Aspartate aminotransferase, mitochondrial
4	9606.ENSP00000438144	0.995	Malate dehydrogenase, cytoplasmic
5	9606.ENSP00000377532	0.985	Pyruvate carboxylase, mitochondrial
6	9606.ENSP00000216254	0.984	Aconitate hydratase, mitochondrial
7	9606.ENSP00000299518	0.984	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
8	9606.ENSP00000358719	0.981	Malic enzyme 1
9	9606.ENSP00000440246	0.981	NADP-dependent malic enzyme, mitochondrial
10	9606.ENSP00000205402	0.979	Dihydrolipoyl dehydrogenase, mitochondrial
11	9606.ENSP00000262030	0.978	ATP synthase subunit beta, mitochondrial
12	9606.ENSP00000253792	0.973	ATP-citrate synthase
13	9606.ENSP00000364649	0.971	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
14	9606.ENSP00000377446	0.971	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
15	9606.ENSP00000359539	0.969	Aspartate aminotransferase, cytoplasmic
16	9606.ENSP00000321070	0.966	NAD-dependent malic enzyme, mitochondrial
17	9606.ENSP00000381736	0.964	ATP synthase subunit alpha, mitochondrial
18	9606.ENSP00000349142	0.963	ATP synthase subunit gamma, mitochondrial
19	9606.ENSP00000452762	0.962	Electron transfer flavoprotein subunit alpha, mitochondrial
20	9606.ENSP00000264932	0.959	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030060	1.000	L-malate dehydrogenase activity
GO:0005488	0.997	binding
GO:0005515	0.953	protein binding
GO:0097159	0.698	organic cyclic compound binding
GO:1901363	0.697	heterocyclic compound binding
GO:0003676	0.589	nucleic acid binding
GO:0003723	0.524	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006091	0.995	generation of precursor metabolites and energy
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0009060	0.993	aerobic respiration
GO:0019752	0.972	carboxylic acid metabolic process
GO:0006099	0.959	tricarboxylic acid cycle
GO:0019318	0.911	hexose metabolic process
GO:0006006	0.868	glucose metabolic process
GO:0006094	0.846	gluconeogenesis
GO:0043648	0.753	dicarboxylic acid metabolic process
GO:0006807	0.480	nitrogen compound metabolic process
GO:1901564	0.385	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031974	0.986	membrane-enclosed lumen
GO:0070013	0.983	intracellular organelle lumen
GO:0005759	0.862	mitochondrial matrix
GO:0016020	0.370	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21432	1.000	(S)-malate + NAD(+) = H(+) + NADH + oxaloacetate
EC:1.1.1.37	1.000	malate dehydrogenase.

[back to server]