StarFunc result for job id P40933

User Input

>input (162 residues)
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40933	1.000	1.000	2.235E-24	162	1.000	1.000	P40933.pdb.gz	IL15_HUMAN Interleukin-15 OS=Homo sapiens OX=9606 GN=IL15 PE=1 SV=1
2	AFDB:P48346	0.779	0.779	2.450E-17	162	0.728	0.728	P48346.pdb.gz	IL15_MOUSE Interleukin-15 OS=Mus musculus OX=10090 GN=Il15 PE=1 SV=1
3	AFDB:O42288	0.525	0.585	1.602E-4	143	0.167	0.189	O42288.pdb.gz	O42288_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
4	AFDB:C7AL04	0.494	0.548	3.177E-4	142	0.222	0.254	C7AL04.pdb.gz	C7AL04_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=IL-2A PE=2 SV=1
5	AFDB:A0A060Y1P2	0.421	0.363	8.877E-4	193	0.222	0.187	A0A060Y1P2.pdb.gz	A0A060Y1P2_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030480001 PE=3 SV=1
6	AFDB:Q9HBE4	0.504	0.504	6.181E-3	162	0.179	0.179	Q9HBE4.pdb.gz	IL21_HUMAN Interleukin-21 OS=Homo sapiens OX=9606 GN=IL21 PE=1 SV=3
7	AFDB:Q2XNF5	0.463	0.423	2.297E-2	183	0.105	0.093	Q2XNF5.pdb.gz	EPO_DANRE Erythropoietin OS=Danio rerio OX=7955 GN=epo PE=1 SV=1
8	PDB:2oqpA	0.488	0.579	2.942E-2	134	0.154	0.187	2oqpA.pdb.gz
9	AFDB:Q9ES17	0.471	0.517	6.061E-2	146	0.136	0.151	Q9ES17.pdb.gz	IL21_MOUSE Interleukin-21 OS=Mus musculus OX=10090 GN=Il21 PE=2 SV=1
10	AFDB:F4MJ51	0.510	0.502	9.569E-2	165	0.148	0.145	F4MJ51.pdb.gz	F4MJ51_ONCMY Interleukin-21 OS=Oncorhynchus mykiss OX=8022 GN=il-21 PE=2 SV=1
11	AFDB:P20826	0.487	0.323	1.013E-1	273	0.167	0.099	P20826.pdb.gz	SCF_MOUSE Kit ligand OS=Mus musculus OX=10090 GN=Kitlg PE=1 SV=1
12	PDB:1buyA	0.464	0.456	1.630E-1	166	0.074	0.072	1buyA.pdb.gz
13	PDB:3qb1G	0.431	0.593	3.838E-1	111	0.142	0.207	3qb1G.pdb.gz
14	PDB:4nemA	0.440	0.586	5.105E-1	114	0.136	0.193	4nemA.pdb.gz	Small molecular fragments bound to binding energy hot-spot in crystal contact interface of Interleukin-2
15	PDB:2gmfA	0.406	0.503	6.059E-1	121	0.099	0.132	2gmfA.pdb.gz
16	PDB:1irlA	0.432	0.504	7.190E-1	133	0.179	0.218	1irlA.pdb.gz
17	PDB:6o4oA	0.365	0.353	1.202	169	0.099	0.095	6o4oA.pdb.gz
18	PDB:3og6A	0.334	0.364	1.272	143	0.086	0.098	3og6A.pdb.gz
19	PDB:2yf3C	0.191	0.200	2.252	153	0.062	0.065	2yf3C.pdb.gz	Structural and Functional Insights Into Dr2231 Protein, the Mazg-Like Nucleoside Triphosphate Pyrophosphohydrolase from Deinococcus Radiodurans.
20	PDB:7zxkC	0.369	0.360	2.252	166	0.086	0.084	7zxkC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40933	5.58e-117	329	162	1.000	1.000	IL15_HUMAN Interleukin-15 OS=Homo sapiens OX=9606 GN=IL15 PE=1 SV=1
2	P97604	6.02e-84	245	162	0.722	0.722	IL15_RAT Interleukin-15 OS=Rattus norvegicus OX=10116 GN=Il15 PE=2 SV=1
3	P48346	2.56e-75	224	162	0.728	0.728	IL15_MOUSE Interleukin-15 OS=Mus musculus OX=10090 GN=Il15 PE=1 SV=1
4	C7AL05	1.51e-05	44.7	142	0.179	0.204	C7AL05_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=IL-2B PE=2 SV=1
5	C8TE57	1.52e-05	44.7	142	0.179	0.204	C8TE57_ONCMY Interleukin (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=il-2 PE=2 SV=1
6	C7AL04	4.01e-05	43.5	142	0.179	0.204	C7AL04_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=IL-2A PE=2 SV=1
7	A0A060Y1P2	0.004	38.1	193	0.241	0.202	A0A060Y1P2_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030480001 PE=3 SV=1
8	Q8JJ00	0.004	38.1	143	0.228	0.259	Q8JJ00_CHICK Interleukin OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q9HBE4	0.004	38.1	162	0.185	0.185	IL21_HUMAN Interleukin-21 OS=Homo sapiens OX=9606 GN=IL21 PE=1 SV=3
10	O42288	0.005	37.7	143	0.228	0.259	O42288_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
11	Q06E04	0.005	37.7	143	0.228	0.259	Q06E04_CHICK Interleukin OS=Gallus gallus murghi OX=400035 GN=IL-2 PE=2 SV=1
12	O73883	0.007	37.4	143	0.222	0.252	O73883_CHICK Interleukin OS=Gallus gallus OX=9031 GN=interleukin-2 PE=2 SV=1
13	Q6UG48	0.007	37.0	142	0.222	0.254	Q6UG48_CHICK Interleukin OS=Gallus gallus OX=9031 PE=2 SV=1
14	Q5UB38	0.008	37.0	142	0.235	0.268	Q5UB38_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
15	Q575Z3	0.009	37.4	193	0.241	0.202	Q575Z3_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=il15 PE=2 SV=1
16	A0A060Y5T2	0.011	37.0	193	0.241	0.202	A0A060Y5T2_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034439001 PE=3 SV=1
17	C1LZ14	0.020	35.0	92	0.093	0.163	C1LZ14_ONCMY Interleukin-2 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=IL-2 PE=4 SV=1
18	O42396	0.021	35.8	143	0.222	0.252	O42396_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL-2 PE=2 SV=1
19	Q6UG49	0.023	35.8	142	0.222	0.254	Q6UG49_CHICK Interleukin OS=Gallus gallus OX=9031 PE=2 SV=1
20	Q7T110	0.061	34.7	143	0.216	0.245	Q7T110_CHICK Interleukin OS=Gallus gallus OX=9031 GN=interleukin-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02372 IL15	2.4e-51	184.7	Interleukin 15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216223	0.999	Interleukin-2 receptor subunit beta
2	9606.ENSP00000380421	0.999	Interleukin 15 receptor subunit alpha
3	9606.ENSP00000363318	0.995	Cytokine receptor common subunit gamma
4	9606.ENSP00000280357	0.969	Interleukin-18
5	9606.ENSP00000226730	0.941	Interleukin-2
6	9606.ENSP00000369293	0.940	Interleukin-2 receptor subunit alpha
7	9606.ENSP00000263851	0.939	Interleukin-7
8	9606.ENSP00000341208	0.917	Signal transducer and activator of transcription 5A
9	9606.ENSP00000306157	0.908	Interleukin-7 receptor subunit alpha
10	9606.ENSP00000240618	0.906	Killer cell lectin-like receptor subfamily K, member 1
11	9606.ENSP00000293328	0.902	Signal transducer and activator of transcription 5B
12	9606.ENSP00000391676	0.886	Tyrosine-protein kinase JAK3
13	9606.ENSP00000296871	0.879	Granulocyte-macrophage colony-stimulating factor
14	9606.ENSP00000011653	0.868	T-cell surface glycoprotein CD4
15	9606.ENSP00000274520	0.865	Interleukin-9
16	9606.ENSP00000231449	0.860	Interleukin-4
17	9606.ENSP00000386559	0.859	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000412237	0.859	Interleukin-10
19	9606.ENSP00000343204	0.842	Tyrosine-protein kinase JAK1
20	9606.ENSP00000264657	0.841	Signal transducer and activator of transcription 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.854	signaling receptor binding
GO:0098772	0.508	molecular function regulator activity
GO:0048018	0.376	receptor ligand activity
GO:0005125	0.303	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.993	cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0042127	0.977	regulation of cell population proliferation
GO:0048522	0.974	positive regulation of cellular process
GO:0019222	0.969	regulation of metabolic process
GO:0032501	0.964	multicellular organismal process
GO:0060255	0.963	regulation of macromolecule metabolic process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0008284	0.937	positive regulation of cell population proliferation
GO:0002376	0.936	immune system process
GO:0050896	0.935	response to stimulus
GO:0080090	0.934	regulation of primary metabolic process
GO:0051173	0.930	positive regulation of nitrogen compound metabolic process
GO:0031325	0.926	positive regulation of cellular metabolic process
GO:0051240	0.900	positive regulation of multicellular organismal process
GO:0010604	0.885	positive regulation of macromolecule metabolic process
GO:0048583	0.854	regulation of response to stimulus
GO:0010468	0.829	regulation of gene expression
GO:0051246	0.825	regulation of protein metabolic process
GO:0048584	0.821	positive regulation of response to stimulus
GO:0032502	0.820	developmental process
GO:0007154	0.817	cell communication
GO:0048856	0.778	anatomical structure development
GO:0051716	0.766	cellular response to stimulus
GO:0051247	0.758	positive regulation of protein metabolic process
GO:0010628	0.729	positive regulation of gene expression
GO:0031399	0.675	regulation of protein modification process
GO:0023052	0.626	signaling
GO:0007165	0.546	signal transduction
GO:0032101	0.538	regulation of response to external stimulus
GO:0019220	0.535	regulation of phosphate metabolic process
GO:0001775	0.484	cell activation
GO:0080134	0.482	regulation of response to stress
GO:0031401	0.481	positive regulation of protein modification process
GO:0006955	0.475	immune response
GO:0002684	0.454	positive regulation of immune system process
GO:0045321	0.432	leukocyte activation
GO:0042325	0.419	regulation of phosphorylation
GO:0031347	0.417	regulation of defense response
GO:0050865	0.416	regulation of cell activation
GO:0002694	0.407	regulation of leukocyte activation
GO:0001932	0.385	regulation of protein phosphorylation
GO:0042327	0.375	positive regulation of phosphorylation
GO:0008152	0.371	metabolic process
GO:0042221	0.368	response to chemical
GO:0070887	0.346	cellular response to chemical stimulus
GO:0010033	0.335	response to organic substance
GO:0030154	0.330	cell differentiation
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.995	extracellular region
GO:0005737	0.994	cytoplasm
GO:0005615	0.968	extracellular space
GO:0071944	0.924	cell periphery
GO:0070013	0.889	intracellular organelle lumen
GO:0005886	0.874	plasma membrane
GO:0005654	0.808	nucleoplasm
GO:0012505	0.620	endomembrane system
GO:0005829	0.586	cytosol
GO:0031410	0.327	cytoplasmic vesicle
GO:0016607	0.318	nuclear speck
GO:0005768	0.303	endosome
GO:0005794	0.301	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]