StarFunc result for job id P40937

User Input

>input (340 residues)
METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYG
PPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFK
LVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPE
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTG
HPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH
LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40937	1.000	1.000	8.631E-56	340	1.000	1.000	P40937.pdb.gz	RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1
2	AFDB:Q503Q7	0.944	0.961	3.400E-48	334	0.803	0.817	Q503Q7.pdb.gz
3	PDB:7z6hG	0.843	0.900	9.997E-42	317	0.932	1.000	7z6hG.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
4	AFDB:Q9VKW3	0.929	0.951	8.596E-41	332	0.591	0.605	Q9VKW3.pdb.gz	Q9VKW3_DROME Replication factor C subunit 3 OS=Drosophila melanogaster OX=7227 GN=RfC3 PE=1 SV=2
5	AFDB:Q9CAQ8	0.918	0.849	9.266E-39	369	0.562	0.518	Q9CAQ8.pdb.gz	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
6	AFDB:O14003	0.940	0.935	6.984E-38	342	0.506	0.503	O14003.pdb.gz	RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc3 PE=1 SV=2
7	AFDB:P38629	0.927	0.927	1.656E-35	340	0.485	0.485	P38629.pdb.gz	RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC3 PE=1 SV=1
8	AFDB:Q38DH5	0.901	0.859	1.851E-34	357	0.459	0.437	Q38DH5.pdb.gz	Q38DH5_TRYB2 Replication factor C, subunit 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3310 PE=3 SV=1
9	PDB:8dqxC	0.853	0.877	4.858E-33	330	0.479	0.494	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
10	AFDB:Q09843	0.898	0.898	7.369E-30	340	0.385	0.385	Q09843.pdb.gz	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
11	AFDB:Q9CAM7	0.843	0.859	6.439E-29	333	0.368	0.375	Q9CAM7.pdb.gz	RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana OX=3702 GN=RFC2 PE=1 SV=1
12	AFDB:Q99J62	0.889	0.833	6.764E-29	364	0.359	0.335	Q99J62.pdb.gz	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1
13	PDB:7z6hD	0.835	0.874	1.424E-25	324	0.365	0.383	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
14	PDB:6vvoB	0.797	0.852	2.838E-25	316	0.341	0.367	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
15	PDB:8dr0D	0.853	0.844	1.127E-24	344	0.350	0.346	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
16	PDB:7tfhB	0.743	0.785	2.875E-24	320	0.326	0.347	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
17	PDB:8dqwE	0.604	0.584	6.831E-18	354	0.262	0.251	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
18	PDB:1sxjE	0.590	0.628	2.583E-17	317	0.247	0.265	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
19	PDB:6vvoE	0.610	0.601	4.726E-16	346	0.238	0.234	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
20	PDB:3u5zB	0.666	0.703	2.821E-14	320	0.224	0.237	3u5zB.pdb.gz	How a DNA polymerase clamp loader opens a sliding clamp.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40937	0.0	704	340	1.000	1.000	RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1
2	Q6DRK4	0.0	593	334	0.812	0.826	Q6DRK4_DANRE Replication factor C (activator 1) 5 OS=Danio rerio OX=7955 GN=zgc:110313 PE=1 SV=1
3	Q9D0F6	0.0	668	339	0.938	0.941	RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus OX=10090 GN=Rfc5 PE=1 SV=1
4	Q9VKW3	4.01e-150	427	332	0.585	0.599	Q9VKW3_DROME Replication factor C subunit 3 OS=Drosophila melanogaster OX=7227 GN=RfC3 PE=1 SV=2
5	Q9CAQ8	9.65e-136	392	369	0.562	0.518	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
6	O14003	7.79e-125	363	342	0.497	0.494	RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc3 PE=1 SV=2
7	Q38DH5	3.30e-118	347	357	0.471	0.448	Q38DH5_TRYB2 Replication factor C, subunit 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3310 PE=3 SV=1
8	P38629	9.92e-118	345	340	0.494	0.494	RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC3 PE=1 SV=1
9	Q09843	1.10e-76	241	340	0.409	0.409	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
10	Q5ZHL1	1.59e-75	238	359	0.382	0.362	Q5ZHL1_CHICK AAA+ ATPase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_37a17 PE=2 SV=1
11	P53033	8.25e-72	229	359	0.350	0.331	RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus OX=9031 GN=RFC2 PE=2 SV=1
12	Q9CAM7	2.34e-71	226	333	0.365	0.372	RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana OX=3702 GN=RFC2 PE=1 SV=1
13	P35249	3.75e-71	227	363	0.374	0.350	RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2
14	P35250	1.28e-70	225	354	0.347	0.333	RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens OX=9606 GN=RFC2 PE=1 SV=3
15	C9JZI1	1.41e-70	224	336	0.382	0.387	C9JZI1_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=1
16	Q9WUK4	1.50e-70	225	349	0.350	0.341	RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus OX=10090 GN=Rfc2 PE=1 SV=1
17	Q9VX15	1.60e-69	223	353	0.353	0.340	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
18	Q6DRF4	3.84e-69	222	358	0.362	0.344	Q6DRF4_DANRE Replication factor C subunit 4 OS=Danio rerio OX=7955 GN=zgc:64030 PE=1 SV=1
19	P53034	6.64e-69	220	331	0.341	0.350	RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster OX=7227 GN=RfC4 PE=1 SV=1
20	Q99J62	7.06e-69	221	364	0.382	0.357	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.5e-12	58.8	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	0.031	25.6	AAA domain
3	PF13173 AAA_14	1.1	20.7	AAA domain
4	PF13191 AAA_16	0.015	27.2	AAA ATPase domain
5	PF13245 AAA_19	0.22	23.2	AAA domain
6	PF13401 AAA_22	0.028	26.1	AAA domain
7	PF13479 AAA_24	0.0031	28.8	AAA domain
8	PF13481 AAA_25	1.9e+02	13.0	AAA domain
9	PF07726 AAA_3	3.3e+02	12.5	ATPase family associated with various cellular activities (AAA)
10	PF13604 AAA_30	13	17.0	AAA domain
11	PF07728 AAA_5	2.8	19.4	AAA domain (dynein-related subfamily)
12	PF12775 AAA_7	19	16.2	P-loop containing dynein motor region
13	PF16193 AAA_assoc_2	0.044	25.4	AAA C-terminal domain
14	PF01637 ATPase_2	1e+02	14.3	ATPase domain predominantly from Archaea
15	PF20030 bpMoxR	2e+02	12.4	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
16	PF00270 DEAD	6	18.1	DEAD/DEAH box helicase
17	PF06144 DNA_pol3_delta	3.5	18.9	DNA polymerase III, delta subunit
18	PF13177 DNA_pol3_delta2	7.4e-10	50.6	DNA polymerase III, delta subunit
19	PF05673 DUF815	0.48	21.0	Protein of unknown function (DUF815)
20	PF01695 IstB_IS21	2.4e+02	12.6	IstB-like ATP binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
3	9606.ENSP00000369411	0.999	Replication factor C subunit 3
4	9606.ENSP00000371321	0.999	Replication factor C subunit 1
5	9606.ENSP00000376272	0.999	Replication factor C subunit 4
6	9606.ENSP00000322180	0.998	Sister chromatid cohesion protein DCC1
7	9606.ENSP00000262315	0.997	Chromosome transmission fidelity protein 18 homolog
8	9606.ENSP00000307288	0.996	DNA replication licensing factor MCM7
9	9606.ENSP00000426191	0.996	Cell cycle checkpoint protein RAD17
10	9606.ENSP00000265056	0.994	DNA replication licensing factor MCM2
11	9606.ENSP00000313171	0.993	ATPase family AAA domain-containing protein 5
12	9606.ENSP00000254719	0.992	Replication protein A 70 kDa DNA-binding subunit
13	9606.ENSP00000408367	0.992	Chromosome transmission fidelity protein 8 homolog
14	9606.ENSP00000350491	0.985	DNA primase small subunit
15	9606.ENSP00000480987	0.981	DNA replication licensing factor MCM3
16	9606.ENSP00000209728	0.980	Cell division control protein 6 homolog
17	9606.ENSP00000262105	0.979	DNA replication licensing factor MCM4
18	9606.ENSP00000480186	0.976	DNA polymerase delta subunit 2
19	9606.ENSP00000484105	0.976	DNA primase large subunit
20	9606.ENSP00000406046	0.974	DNA polymerase delta catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:0003678	0.979	DNA helicase activity
GO:0017116	0.969	single-stranded DNA helicase activity
GO:0003689	0.358	DNA clamp loader activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.960	regulation of cellular process
GO:0019222	0.926	regulation of metabolic process
GO:0051052	0.906	regulation of DNA metabolic process
GO:0048518	0.859	positive regulation of biological process
GO:0051054	0.846	positive regulation of DNA metabolic process
GO:0006275	0.768	regulation of DNA replication
GO:0051338	0.764	regulation of transferase activity
GO:0044093	0.752	positive regulation of molecular function
GO:0009889	0.726	regulation of biosynthetic process
GO:0031326	0.721	regulation of cellular biosynthetic process
GO:2000278	0.708	regulation of DNA biosynthetic process
GO:0071704	0.666	organic substance metabolic process
GO:0009987	0.662	cellular process
GO:0044238	0.639	primary metabolic process
GO:0006807	0.623	nitrogen compound metabolic process
GO:0043170	0.602	macromolecule metabolic process
GO:0044237	0.596	cellular metabolic process
GO:0050896	0.565	response to stimulus
GO:2000573	0.559	positive regulation of DNA biosynthetic process
GO:0034641	0.516	cellular nitrogen compound metabolic process
GO:0090304	0.509	nucleic acid metabolic process
GO:0044260	0.507	cellular macromolecule metabolic process
GO:0006281	0.500	DNA repair
GO:0043085	0.493	positive regulation of catalytic activity
GO:0090329	0.478	regulation of DNA-templated DNA replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	0.998	nucleoplasm
GO:0140513	0.962	nuclear protein-containing complex
GO:0005657	0.933	replication fork
GO:1902494	0.731	catalytic complex
GO:0005737	0.682	cytoplasm
GO:0005829	0.568	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]