StarFunc result for job id P40938

User Input

>input (356 residues)
MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P40938	1.000	1.000	4.670E-60	356	1.000	1.000	P40938.pdb.gz	RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 PE=1 SV=2
2	PDB:6vvoE	0.953	0.980	1.040E-49	346	0.969	0.997	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
3	AFDB:Q7KLW6	0.985	0.888	7.304E-46	395	0.593	0.534	Q7KLW6.pdb.gz	Q7KLW6_DROME LD06837p (Fragment) OS=Drosophila melanogaster OX=7227 GN=RfC38 PE=2 SV=1
4	AFDB:Q18547	0.953	0.959	1.603E-40	354	0.520	0.523	Q18547.pdb.gz	Q18547_CAEEL Replication factor C subunit 3 OS=Caenorhabditis elegans OX=6239 GN=rfc-3 PE=1 SV=1
5	AFDB:O94697	0.961	0.956	8.487E-39	358	0.489	0.486	O94697.pdb.gz	RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc5 PE=1 SV=1
6	AFDB:Q38AG5	0.945	0.964	1.685E-38	349	0.480	0.490	Q38AG5.pdb.gz	Q38AG5_TRYB2 Replication factor C, subunit 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2550 PE=4 SV=1
7	AFDB:P38251	0.941	0.946	4.957E-36	354	0.433	0.435	P38251.pdb.gz	RFC5_YEAST Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC5 PE=1 SV=1
8	PDB:8dqwE	0.919	0.924	2.409E-33	354	0.430	0.432	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
9	PDB:1sxjE	0.831	0.931	4.349E-27	317	0.388	0.435	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
10	AFDB:Q99J62	0.629	0.617	9.441E-20	364	0.250	0.245	Q99J62.pdb.gz	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1
11	AFDB:Q5ZHL1	0.617	0.612	1.330E-19	359	0.261	0.259	Q5ZHL1.pdb.gz	Q5ZHL1_CHICK AAA+ ATPase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_37a17 PE=2 SV=1
12	AFDB:Q9VX15	0.612	0.617	2.516E-19	353	0.244	0.246	Q9VX15.pdb.gz	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
13	AFDB:Q09843	0.602	0.626	3.375E-19	340	0.216	0.226	Q09843.pdb.gz	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
14	PDB:6vvoB	0.548	0.614	6.154E-18	316	0.230	0.259	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
15	PDB:8dr0D	0.610	0.627	3.100E-17	344	0.219	0.227	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
16	PDB:7tfhB	0.602	0.663	5.862E-17	320	0.230	0.256	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
17	PDB:7z6hD	0.602	0.650	7.489E-17	324	0.261	0.287	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
18	PDB:8dqxC	0.563	0.603	1.164E-16	330	0.242	0.261	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
19	PDB:7z6hG	0.536	0.597	8.683E-15	317	0.244	0.274	7z6hG.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
20	PDB:3u5zB	0.535	0.589	2.554E-12	320	0.160	0.178	3u5zB.pdb.gz	How a DNA polymerase clamp loader opens a sliding clamp.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P40938	0.0	740	356	1.000	1.000	RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 PE=1 SV=2
2	Q8R323	0.0	719	356	0.972	0.972	RFC3_MOUSE Replication factor C subunit 3 OS=Mus musculus OX=10090 GN=Rfc3 PE=1 SV=1
3	Q9U9Q1	1.07e-167	473	356	0.590	0.590	Q9U9Q1_DROME Replication factor C 38kD subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=RfC38 PE=1 SV=1
4	Q7KLW6	4.25e-167	473	395	0.590	0.532	Q7KLW6_DROME LD06837p (Fragment) OS=Drosophila melanogaster OX=7227 GN=RfC38 PE=2 SV=1
5	Q18547	6.36e-129	375	354	0.525	0.528	Q18547_CAEEL Replication factor C subunit 3 OS=Caenorhabditis elegans OX=6239 GN=rfc-3 PE=1 SV=1
6	O94697	1.46e-126	369	358	0.494	0.492	RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc5 PE=1 SV=1
7	Q38AG5	2.42e-121	355	349	0.478	0.487	Q38AG5_TRYB2 Replication factor C, subunit 5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2550 PE=4 SV=1
8	P38251	3.46e-98	296	354	0.433	0.435	RFC5_YEAST Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC5 PE=1 SV=1
9	Q93ZX1	3.45e-31	122	339	0.208	0.218	RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana OX=3702 GN=RFC4 PE=1 SV=1
10	F4HY43	5.44e-31	122	341	0.208	0.217	F4HY43_ARATH ATPase family associated with various cellular activities (AAA) OS=Arabidopsis thaliana OX=3702 GN=EMB1968 PE=1 SV=1
11	Q9VX15	1.04e-29	119	353	0.233	0.235	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
12	P40348	5.66e-29	117	353	0.208	0.210	RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC2 PE=1 SV=1
13	Q5ZHL1	1.08e-28	116	359	0.222	0.220	Q5ZHL1_CHICK AAA+ ATPase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_37a17 PE=2 SV=1
14	C9JZI1	1.88e-28	115	336	0.230	0.244	C9JZI1_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=1
15	Q9CAQ8	1.97e-28	115	369	0.225	0.217	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
16	P35249	2.86e-28	115	363	0.230	0.226	RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2
17	Q6DRF4	3.10e-28	115	358	0.216	0.215	Q6DRF4_DANRE Replication factor C subunit 4 OS=Danio rerio OX=7955 GN=zgc:64030 PE=1 SV=1
18	Q6DRK4	4.31e-28	114	334	0.284	0.302	Q6DRK4_DANRE Replication factor C (activator 1) 5 OS=Danio rerio OX=7955 GN=zgc:110313 PE=1 SV=1
19	O14003	6.18e-28	114	342	0.199	0.208	RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc3 PE=1 SV=2
20	Q99J62	6.31e-28	114	364	0.219	0.214	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.00081	31.3	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	17	17.3	AAA ATPase domain
3	PF13245 AAA_19	65	15.2	AAA domain
4	PF13401 AAA_22	39	16.0	AAA domain
5	PF07728 AAA_5	3.6e+02	12.5	AAA domain (dynein-related subfamily)
6	PF00005 ABC_tran	69	15.4	ABC transporter
7	PF14397 ATPgrasp_ST	91	13.7	Sugar-transfer associated ATP-grasp
8	PF03173 CHB_HEX	4.2e+02	12.0	Putative carbohydrate binding domain
9	PF06144 DNA_pol3_delta	9.4	17.5	DNA polymerase III, delta subunit
10	PF13177 DNA_pol3_delta2	1.9e-07	42.8	DNA polymerase III, delta subunit
11	PF10004 DUF2247	3.6e+02	12.3	Uncharacterized protein conserved in bacteria (DUF2247)
12	PF09039 HTH_Tnp_Mu_2	5.1e+02	12.2	Mu DNA binding, I gamma subdomain
13	PF03215 Rad17	0.00095	30.7	Rad17 P-loop domain
14	PF08542 Rep_fac_C	31	16.4	Replication factor C C-terminal domain
15	PF13490 zf-HC2	4.7e+02	12.5	Putative zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001433

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000379	0.999	Replication factor C (activator 1) 5, 36.5kDa
2	61853.ENSNLEP00000008114	0.998	Replication factor C (activator 1) 4, 37kDa
3	61853.ENSNLEP00000009397	0.998	Proliferating cell nuclear antigen
4	61853.ENSNLEP00000010697	0.998	Replication factor C (activator 1) 2, 40kDa
5	61853.ENSNLEP00000020760	0.996	Replication factor C (activator 1) 1, 145kDa
6	61853.ENSNLEP00000010263	0.995	CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)
7	61853.ENSNLEP00000007107	0.994	ATPase family, AAA domain containing 5
8	61853.ENSNLEP00000005132	0.992	RAD17 checkpoint clamp loader component
9	61853.ENSNLEP00000006066	0.986	DNA replication and sister chromatid cohesion 1
10	61853.ENSNLEP00000013974	0.961	DNA helicase
11	61853.ENSNLEP00000006735	0.960	DNA polymerase alpha subunit B
12	61853.ENSNLEP00000003316	0.955	DNA primase large subunit
13	61853.ENSNLEP00000021168	0.954	Primase, DNA, polypeptide 1 (49kDa)
14	61853.ENSNLEP00000004678	0.948	DNA helicase
15	61853.ENSNLEP00000015666	0.947	Plays an important role in the control of DNA replication and the maintenance of replication fork stability.
16	61853.ENSNLEP00000017168	0.947	DNA helicase
17	61853.ENSNLEP00000006838	0.936	Polymerase (DNA directed), delta 1, catalytic subunit
18	61853.ENSNLEP00000010722	0.930	DNA helicase
19	61853.ENSNLEP00000003783	0.929	Flap endonuclease 1
20	61853.ENSNLEP00000004416	0.927	Polymerase (DNA directed), delta 2, accessory subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.999	ATP-dependent activity
GO:0140640	0.997	catalytic activity, acting on a nucleic acid
GO:0008094	0.989	ATP-dependent activity, acting on DNA
GO:1901363	0.913	heterocyclic compound binding
GO:0097159	0.913	organic cyclic compound binding
GO:0003676	0.867	nucleic acid binding
GO:0003689	0.790	DNA clamp loader activity
GO:0003678	0.730	DNA helicase activity
GO:0017116	0.714	single-stranded DNA helicase activity
GO:0003677	0.692	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006260	0.988	DNA replication
GO:0050896	0.985	response to stimulus
GO:0006974	0.978	cellular response to DNA damage stimulus
GO:0050789	0.976	regulation of biological process
GO:0051173	0.972	positive regulation of nitrogen compound metabolic process
GO:0031325	0.968	positive regulation of cellular metabolic process
GO:0006261	0.966	DNA-templated DNA replication
GO:2000278	0.957	regulation of DNA biosynthetic process
GO:0051338	0.956	regulation of transferase activity
GO:0010604	0.945	positive regulation of macromolecule metabolic process
GO:0051054	0.935	positive regulation of DNA metabolic process
GO:0022616	0.929	DNA strand elongation
GO:0006281	0.926	DNA repair
GO:0006271	0.920	DNA strand elongation involved in DNA replication
GO:0006275	0.915	regulation of DNA replication
GO:0044093	0.865	positive regulation of molecular function
GO:2000573	0.857	positive regulation of DNA biosynthetic process
GO:0090329	0.833	regulation of DNA-templated DNA replication
GO:0051347	0.508	positive regulation of transferase activity
GO:0034654	0.507	nucleobase-containing compound biosynthetic process
GO:0071897	0.492	DNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	0.999	nucleoplasm
GO:0140513	0.963	nuclear protein-containing complex
GO:0005657	0.826	replication fork
GO:0005737	0.748	cytoplasm
GO:1902494	0.494	catalytic complex
GO:0016020	0.407	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]