StarFunc result for job id P41002

User Input

>input (786 residues)
MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHS
QLKDLVDNHASVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLKASRFFSLAERLNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQR
THKASILHCLGRVLSLFEDEEKQQQAHDLFEEAAHQGCLTSSYLLWESDRRTDVSDPGRC
LHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASSEIVCQLFQASQAVSKQQVFS
VQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTL
VPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGF
SYEDLIPCVLSLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAAL
GVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETL
LGSFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACP
EDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTSGYSSVSTASPTSSVDGGLGA
LPQPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINLCIHSEEEDMN
LGLVRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41002	1.000	1.000	3.418E-90	786	1.000	1.000	P41002.pdb.gz	CCNF_HUMAN Cyclin-F OS=Homo sapiens OX=9606 GN=CCNF PE=1 SV=2
2	AFDB:P51944	0.802	0.811	3.333E-77	777	0.833	0.843	P51944.pdb.gz	CCNF_MOUSE Cyclin-F OS=Mus musculus OX=10090 GN=Ccnf PE=2 SV=2
3	AFDB:Q39067	0.303	0.517	1.997E-9	445	0.092	0.162	Q39067.pdb.gz	CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-2 PE=1 SV=2
4	PDB:7b5lY	0.283	0.850	1.440E-8	253	0.089	0.277	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
5	AFDB:Q9SA32	0.298	0.579	6.766E-8	396	0.075	0.149	Q9SA32.pdb.gz	CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCB3-1 PE=3 SV=2
6	PDB:7nj0C	0.300	0.825	1.470E-7	270	0.083	0.241	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
7	AFDB:Q39070	0.306	0.545	2.245E-7	429	0.084	0.154	Q39070.pdb.gz	CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCB2-2 PE=1 SV=2
8	PDB:2w96A	0.251	0.738	3.061E-6	249	0.061	0.193	2w96A.pdb.gz
9	PDB:1g3nC	0.251	0.795	2.231E-5	233	0.052	0.176	1g3nC.pdb.gz
10	PDB:3g33B	0.266	0.855	5.089E-5	229	0.056	0.192	3g33B.pdb.gz
11	PDB:4bwrA	0.192	0.293	1.626E-4	467	0.095	0.161	4bwrA.pdb.gz	Crystal Structure of C5321: A Protective Antigen Present in Uropathogenic Escherichia Coli Strains Displaying an Slr Fold.
12	AFDB:Q9CXB8	0.093	0.070	7.644E-4	1231	0.144	0.092	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
13	AFDB:Q9XZ34	0.091	0.066	1.071E-3	1416	0.135	0.075	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
14	AFDB:A0A0G2K6D0	0.157	0.103	2.443E-3	1366	0.125	0.072	A0A0G2K6D0.pdb.gz	A0A0G2K6D0_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6a PE=1 SV=2
15	AFDB:Q96QP1	0.102	0.078	3.176E-3	1244	0.141	0.089	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
16	AFDB:O15550	0.142	0.092	4.620E-3	1401	0.128	0.072	O15550.pdb.gz	KDM6A_HUMAN Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2
17	PDB:7kpvB	0.190	0.477	4.926E-3	290	0.055	0.148	7kpvB.pdb.gz
18	PDB:7jv7B	0.235	0.545	6.648E-3	310	0.051	0.129	7jv7B.pdb.gz
19	PDB:1zp2A	0.219	0.672	1.516E-2	227	0.051	0.176	1zp2A.pdb.gz
20	PDB:6gzhB	0.224	0.636	1.829E-2	252	0.038	0.119	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41002	0.0	1617	786	1.000	1.000	CCNF_HUMAN Cyclin-F OS=Homo sapiens OX=9606 GN=CCNF PE=1 SV=2
2	P51944	0.0	1284	777	0.835	0.844	CCNF_MOUSE Cyclin-F OS=Mus musculus OX=10090 GN=Ccnf PE=2 SV=2
3	Q7TMA5	1.55e-102	350	4743	0.243	0.040	APOB_RAT Apolipoprotein B-100 OS=Rattus norvegicus OX=10116 GN=Apob PE=1 SV=1
4	Q98TA3	1.57e-31	130	428	0.098	0.180	Q98TA3_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=CycA2 PE=2 SV=1
5	Q6NV43	1.58e-31	130	428	0.098	0.180	Q6NV43_DANRE Cyclin-A2 OS=Danio rerio OX=7955 GN=chunp6924 PE=2 SV=2
6	Q9C6A9	1.02e-27	117	372	0.089	0.188	CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1
7	A0A0G2JVY9	2.07e-27	117	418	0.094	0.177	A0A0G2JVY9_RAT Cyclin-A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=3 SV=2
8	P51943	2.58e-27	117	422	0.094	0.175	CCNA2_MOUSE Cyclin-A2 OS=Mus musculus OX=10090 GN=Ccna2 PE=1 SV=2
9	P30274	2.85e-27	117	430	0.094	0.172	CCNA2_BOVIN Cyclin-A2 OS=Bos taurus OX=9913 GN=CCNA2 PE=1 SV=2
10	Q9FMH5	1.44e-26	114	355	0.083	0.183	CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-1 PE=3 SV=1
11	P20248	1.57e-26	115	432	0.093	0.169	CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens OX=9606 GN=CCNA2 PE=1 SV=2
12	Q9C6Y3	3.36e-26	115	460	0.090	0.154	CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-1 PE=1 SV=1
13	A0JPK0	4.71e-26	112	338	0.093	0.216	A0JPK0_RAT Ccna2 protein OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=2 SV=1
14	P78396	7.24e-26	114	465	0.116	0.196	CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens OX=9606 GN=CCNA1 PE=1 SV=1
15	G3V802	7.64e-26	112	380	0.093	0.192	G3V802_RAT Cyclin A2 OS=Rattus norvegicus OX=10116 GN=Ccna2 PE=1 SV=2
16	Q9FVX0	9.93e-26	113	442	0.090	0.161	CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-2 PE=1 SV=2
17	Q3ECW2	1.24e-25	111	370	0.097	0.205	CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-4 PE=1 SV=1
18	Q39069	1.28e-25	112	414	0.084	0.159	CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana OX=3702 GN=CYCB1-3 PE=2 SV=2
19	Q147G5	4.44e-25	111	436	0.087	0.156	CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-2 PE=2 SV=1
20	Q38819	6.49e-25	110	450	0.088	0.153	CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA2-3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	4e-16	70.6	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	3.9e-25	99.5	Cyclin, N-terminal domain
3	PF00646 F-box	0.0015	29.6	F-box domain
4	PF12937 F-box-like	0.012	26.8	F-box-like
5	PF15874 Il2rg	5.8e+02	12.2	Putative Interleukin 2 receptor, gamma chain
6	PF08238 Sel1	16	17.6	Sel1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.986	Cullin-1
3	9606.ENSP00000370803	0.981	Centriolar coiled-coil protein of 110 kDa
4	9606.ENSP00000361540	0.958	Cell division cycle protein 20 homolog
5	9606.ENSP00000378699	0.934	Cyclin-dependent kinase 1
6	9606.ENSP00000257934	0.910	Separin
7	9606.ENSP00000353770	0.882	Ribonucleoside-diphosphate reductase subunit M2
8	9606.ENSP00000209728	0.870	Cell division control protein 6 homolog
9	9606.ENSP00000262643	0.862	G1/S-specific cyclin-E1
10	9606.ENSP00000453403	0.856	Nucleolar and spindle-associated protein 1
11	9606.ENSP00000256442	0.854	G2/mitotic-specific cyclin-B1
12	9606.ENSP00000311083	0.854	Cyclin-dependent kinases regulatory subunit 1
13	9606.ENSP00000216225	0.853	E3 ubiquitin-protein ligase RBX1
14	9606.ENSP00000274026	0.851	Cyclin-A2
15	9606.ENSP00000274255	0.842	S-phase kinase-associated protein 2
16	9606.ENSP00000266970	0.831	Cyclin-dependent kinase 2
17	9606.ENSP00000357643	0.830	Proliferation marker protein Ki-67
18	9606.ENSP00000216122	0.826	DNA replication licensing factor MCM5
19	9606.ENSP00000288207	0.824	G2/mitotic-specific cyclin-B2
20	9606.ENSP00000364976	0.823	Cyclin-dependent kinases regulatory subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.998	protein-containing complex binding
GO:0005515	0.998	protein binding
GO:0010997	0.599	anaphase-promoting complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0010564	0.989	regulation of cell cycle process
GO:0043170	0.987	macromolecule metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0044260	0.964	cellular macromolecule metabolic process
GO:0051493	0.963	regulation of cytoskeleton organization
GO:0019538	0.957	protein metabolic process
GO:0043412	0.954	macromolecule modification
GO:0046605	0.953	regulation of centrosome cycle
GO:0010824	0.944	regulation of centrosome duplication
GO:0006511	0.938	ubiquitin-dependent protein catabolic process
GO:0045786	0.937	negative regulation of cell cycle
GO:0010639	0.929	negative regulation of organelle organization
GO:0036211	0.923	protein modification process
GO:0010498	0.914	proteasomal protein catabolic process
GO:0010948	0.910	negative regulation of cell cycle process
GO:0043161	0.889	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051494	0.869	negative regulation of cytoskeleton organization
GO:0031146	0.850	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0007049	0.504	cell cycle
GO:0032446	0.478	protein modification by small protein conjugation
GO:0022402	0.463	cell cycle process
GO:0016567	0.391	protein ubiquitination
GO:0048518	0.380	positive regulation of biological process
GO:0019222	0.373	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:1990234	0.998	transferase complex
GO:0140535	0.991	intracellular protein-containing complex
GO:0015630	0.989	microtubule cytoskeleton
GO:0000151	0.963	ubiquitin ligase complex
GO:0005654	0.963	nucleoplasm
GO:0005815	0.960	microtubule organizing center
GO:0031461	0.941	cullin-RING ubiquitin ligase complex
GO:0005813	0.928	centrosome
GO:0019005	0.912	SCF ubiquitin ligase complex
GO:0005814	0.828	centriole
GO:0030054	0.827	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]