StarFunc result for job id P41091

User Input

>input (472 residues)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41091	1.000	1.000	8.932E-103	472	1.000	1.000	P41091.pdb.gz	IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3
2	AFDB:O64490	0.964	0.979	2.497E-83	465	0.693	0.703	O64490.pdb.gz	O64490_ARATH protein-synthesizing GTPase OS=Arabidopsis thaliana OX=3702 GN=EIF2 PE=1 SV=1
3	AFDB:Q09130	0.935	0.990	1.425E-82	446	0.710	0.751	Q09130.pdb.gz	IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif213 PE=2 SV=1
4	AFDB:P32481	0.944	0.846	4.908E-81	527	0.699	0.626	P32481.pdb.gz	IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD11 PE=1 SV=1
5	AFDB:Q382L1	0.941	0.931	4.429E-70	477	0.513	0.507	Q382L1.pdb.gz	Q382L1_TRYB2 Eukaryotic translation initiation factor 2 gamma, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4830 PE=4 SV=1
6	PDB:6fyxk	0.819	0.930	2.431E-58	414	0.657	0.749	6fyxk.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
7	AFDB:Q8U082	0.830	0.950	1.230E-57	411	0.417	0.479	Q8U082.pdb.gz	IF2G_PYRFU Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2g PE=1 SV=1
8	AFDB:Q980A5	0.837	0.950	1.230E-57	415	0.386	0.439	Q980A5.pdb.gz	IF2G_SACS2 Translation initiation factor 2 subunit gamma OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eif2g PE=1 SV=1
9	PDB:7qp6t	0.705	0.925	7.490E-56	356	0.744	0.986	7qp6t.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
10	PDB:3j81k	0.739	0.950	1.749E-49	365	0.587	0.759	3j81k.pdb.gz	Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
11	PDB:7a09Y	0.776	0.877	5.379E-49	414	0.847	0.966	7a09Y.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
12	PDB:2dcuA	0.751	0.862	7.971E-49	407	0.413	0.479	2dcuA.pdb.gz	Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
13	PDB:7d43P	0.716	0.792	6.035E-46	421	0.892	1.000	7d43P.pdb.gz	ISRIB Blunts the Integrated Stress Response by Allosterically Antagonising the Inhibitory Effect of Phosphorylated eIF2 on eIF2B.
14	AFDB:C2E605	0.662	0.782	5.733E-32	396	0.225	0.268	C2E605.pdb.gz	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
15	AFDB:A0A384ME17	0.664	0.688	1.576E-31	455	0.231	0.240	A0A384ME17.pdb.gz	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
16	AFDB:P14081	0.635	0.496	8.993E-31	614	0.201	0.155	P14081.pdb.gz	SELB_ECOLI Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) OX=83333 GN=selB PE=1 SV=3
17	PDB:3qsyA	0.593	0.659	8.105E-30	415	0.379	0.431	3qsyA.pdb.gz	Crystal structure of the archaeal translation initiation factor 2 in complex with a GTP analogue and Met-tRNAf(Met.)
18	PDB:7a5gZ	0.663	0.786	2.232E-27	394	0.214	0.256	7a5gZ.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
19	PDB:5lzbz	0.629	0.492	4.384E-26	614	0.199	0.153	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
20	PDB:6ji2A	0.625	0.679	1.688E-25	432	0.206	0.225	6ji2A.pdb.gz	Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O64490	0.0	683	465	0.693	0.703	O64490_ARATH protein-synthesizing GTPase OS=Arabidopsis thaliana OX=3702 GN=EIF2 PE=1 SV=1
2	P32481	0.0	689	527	0.695	0.622	IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD11 PE=1 SV=1
3	P41091	0.0	962	472	1.000	1.000	IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3
4	P81795	0.0	960	472	0.998	0.998	IF2G_RAT Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Rattus norvegicus OX=10116 GN=Eif2s3 PE=1 SV=2
5	Q09130	0.0	703	446	0.712	0.753	IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif213 PE=2 SV=1
6	Q9Z0N1	0.0	957	472	0.996	0.996	IF2G_MOUSE Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus OX=10090 GN=Eif2s3x PE=1 SV=2
7	Q382L1	1.57e-173	498	477	0.511	0.505	Q382L1_TRYB2 Eukaryotic translation initiation factor 2 gamma, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4830 PE=4 SV=1
8	Q8U082	1.58e-125	373	411	0.422	0.484	IF2G_PYRFU Translation initiation factor 2 subunit gamma OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=eif2g PE=1 SV=1
9	Q980A5	1.42e-117	353	415	0.392	0.446	IF2G_SACS2 Translation initiation factor 2 subunit gamma OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=eif2g PE=1 SV=1
10	P45975	2.26e-29	123	635	0.136	0.101	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
11	P50062	5.31e-21	97.1	394	0.176	0.211	EFTU_BORBU Elongation factor Tu OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=tuf PE=3 SV=1
12	C2E605	3.71e-19	91.3	396	0.178	0.212	C2E605_LACJH Elongation factor Tu OS=Lactobacillus johnsonii ATCC 33200 OX=525330 GN=tuf PE=3 SV=1
13	Q74JU6	3.71e-19	91.3	396	0.178	0.212	EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) OX=257314 GN=tuf PE=3 SV=1
14	Q388R1	3.87e-19	92.0	470	0.203	0.204	Q388R1_TRYB2 Elongation factor TU, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0070 PE=4 SV=1
15	P14081	7.88e-19	91.7	614	0.208	0.160	SELB_ECOLI Selenocysteine-specific elongation factor OS=Escherichia coli (strain K12) OX=83333 GN=selB PE=1 SV=3
16	P49410	9.59e-19	90.5	452	0.167	0.175	EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus OX=9913 GN=TUFM PE=1 SV=1
17	Q8BFR5	1.24e-18	90.5	452	0.165	0.173	EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1
18	P85834	1.31e-18	90.1	452	0.165	0.173	EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tufm PE=1 SV=1
19	A0A384ME17	1.75e-18	89.7	455	0.163	0.169	A0A384ME17_HUMAN Elongation factor Tu OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=1
20	P49411	1.75e-18	89.7	455	0.163	0.169	EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00350 Dynamin_N	5e+02	12.2	Dynamin family
2	PF09173 eIF2_C	8.7e-31	117.3	Initiation factor eIF2 gamma, C terminal
3	PF00503 G-alpha	4.7e+02	11.3	G-protein alpha subunit
4	PF00009 GTP_EFTU	8e-19	79.5	Elongation factor Tu GTP binding domain
5	PF03144 GTP_EFTU_D2	1.7e-09	49.2	Elongation factor Tu domain 2
6	PF01926 MMR_HSR1	14	17.2	50S ribosome-binding GTPase
7	PF16897 MMR_HSR1_Xtn	35	15.8	C-terminal region of MMR_HSR1 domain
8	PF03193 RsgA_GTPase	8.8	17.7	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006835630.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006831463.1	0.999	Eukaryotic translation initiation factor 3 subunit A
2	185453.XP_006859850.1	0.999	Eukaryotic translation initiation factor 3 subunit B
3	185453.XP_006860737.1	0.999	Eukaryotic translation initiation factor 2 subunit 2
4	185453.XP_006873116.1	0.999	Eukaryotic translation initiation factor 2 subunit 1
5	185453.XP_006839909.1	0.998	Translation initiation factor eIF-2B subunit gamma
6	185453.XP_006869862.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 10 Proteins
7	185453.XP_006875221.1	0.998	Eukaryotic translation initiation factor 3 subunit G
8	185453.XP_006862226.1	0.997	Eukaryotic translation initiation factor 3 subunit I
9	185453.XP_006865429.1	0.997	Translation initiation factor eIF-2B subunit alpha
10	185453.XP_006865583.1	0.997	Translation initiation factor eIF-2B subunit beta
11	185453.XP_006868048.1	0.997	Eukaryotic translation initiation factor 2A isoform X1
12	185453.XP_006839572.1	0.996	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 16 Proteins
13	185453.XP_006877100.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 mRNAs, 22 Proteins
14	185453.XP_006877130.1	0.994	Eukaryotic translation initiation factor 3 subunit C-like protein-like
15	185453.XP_006830704.1	0.993	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 18 Proteins
16	185453.XP_006873038.1	0.993	Eukaryotic translation initiation factor 3 subunit F
17	185453.XP_006835650.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 33 Proteins
18	185453.XP_006871545.1	0.991	Carcinoembryonic antigen-related cell adhesion molecule 16
19	185453.XP_006871497.1	0.990	40S ribosomal protein S16
20	185453.XP_006839753.1	0.987	40S ribosomal protein S8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003743	1.000	translation initiation factor activity
GO:0050839	0.999	cell adhesion molecule binding
GO:0003824	0.979	catalytic activity
GO:0016818	0.957	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003924	0.949	GTPase activity
GO:0045296	0.910	cadherin binding
GO:0003723	0.903	RNA binding
GO:0000166	0.365	nucleotide binding
GO:0043167	0.348	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0006413	0.991	translational initiation
GO:0065007	0.585	biological regulation
GO:0050789	0.581	regulation of biological process
GO:0050794	0.569	regulation of cellular process
GO:0019222	0.365	regulation of metabolic process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0002181	0.314	cytoplasmic translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0032991	0.993	protein-containing complex
GO:0043227	0.991	membrane-bounded organelle
GO:0005737	0.990	cytoplasm
GO:0005829	0.982	cytosol
GO:0005576	0.963	extracellular region
GO:0070013	0.934	intracellular organelle lumen
GO:0031982	0.909	vesicle
GO:0016020	0.894	membrane
GO:0043230	0.892	extracellular organelle
GO:0070062	0.883	extracellular exosome
GO:0031981	0.858	nuclear lumen
GO:0043232	0.829	intracellular non-membrane-bounded organelle
GO:0005654	0.412	nucleoplasm
GO:0030054	0.371	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.957	In phosphorus-containing anhydrides.
RHEA:19669	0.949	GTP + H2O = GDP + H(+) + phosphate

[back to server]