StarFunc result for job id P41134

User Input

>input (155 residues)
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41134	1.000	1.000	8.839E-24	155	1.000	1.000	P41134.pdb.gz	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
2	AFDB:P20067	0.502	0.466	2.732E-16	168	0.832	0.768	P20067.pdb.gz	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
3	AFDB:O73933	0.360	0.412	5.688E-7	134	0.400	0.463	O73933.pdb.gz	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
4	AFDB:Q7SZQ2	0.400	0.443	8.549E-7	137	0.368	0.416	Q7SZQ2.pdb.gz	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
5	AFDB:Q9PWJ5	0.370	0.420	2.712E-6	133	0.374	0.436	Q9PWJ5.pdb.gz	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
6	AFDB:Q7ZXF3	0.344	0.399	6.162E-5	131	0.406	0.481	Q7ZXF3.pdb.gz	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
7	AFDB:Q90X15	0.298	0.385	1.300E-4	118	0.439	0.576	Q90X15.pdb.gz	Q90X15_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id1 PE=2 SV=1
8	AFDB:P41139	0.299	0.288	3.163E-3	161	0.419	0.404	P41139.pdb.gz	ID4_MOUSE DNA-binding protein inhibitor ID-4 OS=Mus musculus OX=10090 GN=Id4 PE=1 SV=1
9	AFDB:Q7RTS1	0.326	0.270	3.163E-3	189	0.194	0.159	Q7RTS1.pdb.gz	BHA15_HUMAN Class A basic helix-loop-helix protein 15 OS=Homo sapiens OX=9606 GN=BHLHA15 PE=1 SV=1
10	AFDB:P57102	0.288	0.220	5.087E-3	208	0.161	0.120	P57102.pdb.gz	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
11	PDB:7suk5	0.229	0.129	1.040	296	0.097	0.051	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
12	PDB:3ojaA	0.191	0.069	1.790	482	0.129	0.041	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:2rvqD	0.134	0.160	2.195	129	0.129	0.155	2rvqD.pdb.gz
14	PDB:6zx9C	0.201	0.132	2.349	257	0.110	0.066	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
15	PDB:5nrlV	0.182	0.221	2.514	127	0.097	0.118	5nrlV.pdb.gz	Structure of a pre-catalytic spliceosome.
16	PDB:7z0oD	0.141	0.082	2.880	296	0.123	0.064	7z0oD.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.
17	PDB:1or7B	0.142	0.135	3.299	164	0.084	0.079	1or7B.pdb.gz
18	PDB:4etsB	0.173	0.178	3.299	149	0.097	0.101	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
19	PDB:7edxk	0.161	0.258	3.530	98	0.103	0.163	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:2bskC	0.177	0.309	3.778	79	0.084	0.165	2bskC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41134	1.39e-109	310	155	1.000	1.000	ID1_HUMAN DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3
2	P41135	6.98e-74	220	164	0.742	0.701	ID1_RAT DNA-binding protein inhibitor ID-1 OS=Rattus norvegicus OX=10116 GN=Id1 PE=1 SV=1
3	P20067	7.46e-74	220	168	0.742	0.685	ID1_MOUSE DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3
4	Q6IQW5	1.17e-44	144	128	0.497	0.602	Q6IQW5_DANRE DNA-binding protein inhibitor ID-1 OS=Danio rerio OX=7955 GN=cb108 PE=1 SV=1
5	P41137	2.70e-28	103	134	0.361	0.418	ID2_RAT DNA-binding protein inhibitor ID-2 OS=Rattus norvegicus OX=10116 GN=Id2 PE=1 SV=1
6	P41136	3.36e-28	103	134	0.361	0.418	ID2_MOUSE DNA-binding protein inhibitor ID-2 OS=Mus musculus OX=10090 GN=Id2 PE=1 SV=3
7	Q3LSV1	3.59e-28	103	134	0.335	0.388	Q3LSV1_COTJA Id2 OS=Coturnix japonica OX=93934 GN=Id2 PE=2 SV=1
8	O73933	3.79e-28	103	134	0.374	0.433	O73933_CHICK Id2 OS=Gallus gallus OX=9031 GN=ID2 PE=2 SV=1
9	Q02363	8.36e-28	102	134	0.368	0.425	ID2_HUMAN DNA-binding protein inhibitor ID-2 OS=Homo sapiens OX=9606 GN=ID2 PE=1 SV=1
10	Q7ZXF3	2.13e-27	101	131	0.387	0.458	ID4_XENLA DNA-binding protein inhibitor ID-4 OS=Xenopus laevis OX=8355 GN=id4 PE=2 SV=1
11	Q7SZQ2	3.68e-27	100	137	0.355	0.401	Q7SZQ2_DANRE DNA-binding protein inhibitor ID-2 OS=Danio rerio OX=7955 GN=id2 PE=2 SV=1
12	Q9PWJ5	2.61e-26	98.6	133	0.316	0.368	ID2A_XENLA DNA-binding protein inhibitor ID-2-A OS=Xenopus laevis OX=8355 GN=id2-a PE=2 SV=1
13	Q8QFX4	1.96e-23	90.5	116	0.316	0.422	Q8QFX4_DANRE DNA-binding protein inhibitor ID-3 OS=Danio rerio OX=7955 GN=ik:tdsubc_2g3 PE=2 SV=1
14	Q91399	2.21e-23	90.5	118	0.323	0.424	ID3A_XENLA DNA-binding protein inhibitor ID-3-A OS=Xenopus laevis OX=8355 GN=id3-a PE=1 SV=1
15	Q90X14	3.90e-23	90.1	125	0.413	0.512	Q90X14_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id3 PE=2 SV=1
16	Q32PN8	5.66e-23	89.7	126	0.335	0.413	Q32PN8_DANRE DNA-binding protein inhibitor ID-4 OS=Danio rerio OX=7955 GN=zgc:123214 PE=2 SV=1
17	Q02535	1.64e-20	83.2	119	0.348	0.454	ID3_HUMAN DNA-binding protein inhibitor ID-3 OS=Homo sapiens OX=9606 GN=ID3 PE=1 SV=2
18	P41133	2.58e-20	82.8	119	0.329	0.429	ID3_MOUSE DNA-binding protein inhibitor ID-3 OS=Mus musculus OX=10090 GN=Id3 PE=1 SV=1
19	Q90X15	2.66e-20	82.4	118	0.303	0.398	Q90X15_CHICK Helix-loop-helix protein OS=Gallus gallus OX=9031 GN=Id1 PE=2 SV=1
20	P41138	3.04e-20	82.4	119	0.323	0.420	ID3_RAT DNA-binding protein inhibitor ID-3 OS=Rattus norvegicus OX=10116 GN=Id3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11988 Dsl1_N	78	13.7	Retrograde transport protein Dsl1 N terminal
2	PF00010 HLH	4.4e-10	50.7	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365280

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381382	0.992	Transcription factor 4
2	9606.ENSP00000262965	0.987	Transcription factor E2-alpha
3	9606.ENSP00000385824	0.987	Forkhead box protein O3
4	9606.ENSP00000250003	0.985	Myoblast determination protein 1
5	9606.ENSP00000388940	0.974	Transcription factor 12
6	9606.ENSP00000339191	0.948	Caveolin-1
7	9606.ENSP00000363689	0.940	DNA-binding protein inhibitor ID-3
8	9606.ENSP00000264824	0.928	Protein lyl-1
9	9606.ENSP00000263253	0.924	Histone acetyltransferase p300
10	9606.ENSP00000387699	0.917	Cyclic AMP-responsive element-binding protein 1
11	9606.ENSP00000260356	0.898	Thrombospondin-1
12	9606.ENSP00000361540	0.886	Cell division cycle protein 20 homolog
13	9606.ENSP00000353344	0.884	Protein C-ets-2
14	9606.ENSP00000367408	0.871	Peripheral plasma membrane protein CASK
15	9606.ENSP00000266744	0.830	Achaete-scute homolog 1
16	9606.ENSP00000250559	0.800	Ras-related protein Rap-1b
17	9606.ENSP00000358723	0.800	Ras-related protein Rap-1A
18	9606.ENSP00000376436	0.800	Protein C-ets-1
19	9606.ENSP00000435770	0.712	Achaete-scute homolog 3
20	9606.ENSP00000341551	0.668	Mothers against decapentaplegic homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140416	1.000	transcription regulator inhibitor activity
GO:0140110	0.746	transcription regulator activity
GO:0097159	0.656	organic cyclic compound binding
GO:0003677	0.651	DNA binding
GO:0043565	0.626	sequence-specific DNA binding
GO:0003700	0.475	DNA-binding transcription factor activity
GO:1990837	0.475	sequence-specific double-stranded DNA binding
GO:0000976	0.420	transcription cis-regulatory region binding
GO:0000981	0.331	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.331	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.991	negative regulation of cellular process
GO:0009987	0.990	cellular process
GO:0010468	0.990	regulation of gene expression
GO:0048856	0.986	anatomical structure development
GO:0051252	0.985	regulation of RNA metabolic process
GO:0050896	0.983	response to stimulus
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0032501	0.975	multicellular organismal process
GO:0006357	0.953	regulation of transcription by RNA polymerase II
GO:0000122	0.920	negative regulation of transcription by RNA polymerase II
GO:0007275	0.916	multicellular organism development
GO:0070848	0.907	response to growth factor
GO:0051716	0.885	cellular response to stimulus
GO:0048518	0.884	positive regulation of biological process
GO:0048731	0.874	system development
GO:0048522	0.833	positive regulation of cellular process
GO:0007154	0.831	cell communication
GO:0023052	0.830	signaling
GO:0007165	0.818	signal transduction
GO:0044092	0.792	negative regulation of molecular function
GO:0010604	0.783	positive regulation of macromolecule metabolic process
GO:0071363	0.734	cellular response to growth factor stimulus
GO:0007166	0.681	cell surface receptor signaling pathway
GO:0048869	0.565	cellular developmental process
GO:0030154	0.509	cell differentiation
GO:0007167	0.484	enzyme-linked receptor protein signaling pathway
GO:0050793	0.483	regulation of developmental process
GO:0051173	0.445	positive regulation of nitrogen compound metabolic process
GO:0031325	0.406	positive regulation of cellular metabolic process
GO:0042221	0.403	response to chemical
GO:0045595	0.402	regulation of cell differentiation
GO:0051239	0.386	regulation of multicellular organismal process
GO:0009653	0.361	anatomical structure morphogenesis
GO:0009891	0.345	positive regulation of biosynthetic process
GO:0048513	0.344	animal organ development
GO:0031328	0.344	positive regulation of cellular biosynthetic process
GO:0045935	0.338	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.337	positive regulation of macromolecule biosynthetic process
GO:0007178	0.331	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045893	0.319	positive regulation of DNA-templated transcription
GO:0048583	0.314	regulation of response to stimulus
GO:0008152	0.309	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0012505	0.967	endomembrane system
GO:0005794	0.545	Golgi apparatus
GO:0043232	0.365	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]