StarFunc result for job id P41159

User Input

>input (167 residues)
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41159	1.000	1.000	5.927E-24	167	1.000	1.000	P41159.pdb.gz	LEP_HUMAN Leptin OS=Homo sapiens OX=9606 GN=LEP PE=1 SV=1
2	AFDB:G8BLB4	0.926	0.926	9.368E-19	167	0.844	0.844	G8BLB4.pdb.gz	G8BLB4_BOVIN Leptin OS=Bos taurus OX=9913 GN=LEP PE=3 SV=1
3	AFDB:P41160	0.935	0.935	1.034E-18	167	0.832	0.832	P41160.pdb.gz	LEP_MOUSE Leptin OS=Mus musculus OX=10090 GN=Lep PE=1 SV=1
4	PDB:1ax8A	0.669	0.847	3.836E-13	130	0.766	0.985	1ax8A.pdb.gz
5	AFDB:A0A023GUT0	0.708	0.689	9.892E-7	172	0.263	0.256	A0A023GUT0.pdb.gz	A0A023GUT0_TAEGU Leptin OS=Taeniopygia guttata OX=59729 GN=LPN PE=2 SV=1
6	AFDB:Q0D250	0.705	0.709	4.336E-6	166	0.257	0.259	Q0D250.pdb.gz	Q0D250_DANRE Leptin OS=Danio rerio OX=7955 GN=ob-a PE=2 SV=1
7	AFDB:B0M1K7	0.727	0.712	4.847E-5	171	0.251	0.246	B0M1K7.pdb.gz	B0M1K7_ONCMY Leptin OS=Oncorhynchus mykiss OX=8022 GN=lep PE=2 SV=1
8	AFDB:C4WYH6	0.615	0.612	1.080E-3	168	0.234	0.232	C4WYH6.pdb.gz	C4WYH6_DANRE Leptin OS=Danio rerio OX=7955 GN=ob-b PE=2 SV=1
9	AFDB:Q9QZM3	0.634	0.482	2.753E-3	225	0.168	0.124	Q9QZM3.pdb.gz	CLCF1_MOUSE Cardiotrophin-like cytokine factor 1 OS=Mus musculus OX=10090 GN=Clcf1 PE=1 SV=1
10	AFDB:B8ZHI7	0.624	0.477	3.886E-3	224	0.180	0.134	B8ZHI7.pdb.gz	B8ZHI7_DANRE Colony-stimulating factor 3 (granulocyte) a OS=Danio rerio OX=7955 GN=gcsf PE=2 SV=1
11	AFDB:P97712	0.613	0.489	4.505E-3	214	0.192	0.150	P97712.pdb.gz	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
12	PDB:4cniC	0.558	0.548	1.910E-2	171	0.114	0.111	4cniC.pdb.gz
13	PDB:7z0lB	0.539	0.264	2.215E-2	370	0.120	0.054	7z0lB.pdb.gz
14	PDB:6o4oA	0.570	0.564	3.807E-2	169	0.144	0.142	6o4oA.pdb.gz
15	PDB:7zxkC	0.523	0.526	5.932E-2	166	0.132	0.133	7zxkC.pdb.gz
16	PDB:1rhgB	0.552	0.626	7.224E-2	144	0.138	0.160	1rhgB.pdb.gz
17	PDB:7u7nD	0.551	0.489	8.374E-2	191	0.156	0.136	7u7nD.pdb.gz
18	PDB:4zs7A	0.532	0.625	8.797E-2	139	0.144	0.173	4zs7A.pdb.gz
19	PDB:1cnt1	0.560	0.618	1.242E-1	150	0.090	0.100	1cnt1.pdb.gz
20	PDB:1f6fA	0.578	0.533	1.305E-1	183	0.102	0.093	1f6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41159	2.59e-121	340	167	1.000	1.000	LEP_HUMAN Leptin OS=Homo sapiens OX=9606 GN=LEP PE=1 SV=1
2	Q29406	1.12e-99	286	167	0.850	0.850	LEP_PIG Leptin OS=Sus scrofa OX=9823 GN=LEP PE=2 SV=1
3	P50595	5.21e-99	284	167	0.844	0.844	LEP_BOVIN Leptin OS=Bos taurus OX=9913 GN=LEP PE=2 SV=1
4	G8BLB4	3.92e-98	282	167	0.844	0.844	G8BLB4_BOVIN Leptin OS=Bos taurus OX=9913 GN=LEP PE=3 SV=1
5	P41160	1.78e-97	280	167	0.832	0.832	LEP_MOUSE Leptin OS=Mus musculus OX=10090 GN=Lep PE=1 SV=1
6	P50596	2.85e-95	275	167	0.820	0.820	LEP_RAT Leptin OS=Rattus norvegicus OX=10116 GN=Lep PE=1 SV=1
7	O42164	1.04e-87	255	163	0.790	0.810	LEP_CHICK Leptin OS=Gallus gallus OX=9031 GN=LEP PE=2 SV=1
8	Q8MJ10	1.46e-43	141	86	0.407	0.791	Q8MJ10_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 PE=3 SV=1
9	Q1H629	4.50e-21	82.8	48	0.240	0.833	Q1H629_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=OBESE PE=3 SV=1
10	U3GMG1	9.81e-21	82.0	48	0.240	0.833	U3GMG1_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=ob PE=3 SV=1
11	U3GPL7	1.22e-20	81.6	48	0.240	0.833	U3GPL7_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=ob PE=3 SV=1
12	Q95MZ8	1.55e-20	81.6	48	0.234	0.812	Q95MZ8_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 PE=3 SV=1
13	U3GLJ1	1.69e-20	81.3	48	0.240	0.833	U3GLJ1_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=ob PE=4 SV=1
14	Q8HZ50	2.31e-20	81.3	48	0.240	0.833	Q8HZ50_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=ob PE=4 SV=1
15	U3GLD7	2.31e-20	81.3	48	0.240	0.833	U3GLD7_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=ob PE=4 SV=1
16	Q5XWB7	4.67e-20	80.1	42	0.222	0.881	Q5XWB7_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=obese PE=3 SV=1
17	Q6QLP8	2.66e-19	78.2	42	0.216	0.857	Q6QLP8_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 GN=obese PE=3 SV=1
18	Q95L03	4.40e-09	51.6	25	0.138	0.920	Q95L03_BOVIN Leptin (Fragment) OS=Bos taurus OX=9913 PE=2 SV=1
19	A0A023GUT0	1.52e-04	42.4	172	0.210	0.203	A0A023GUT0_TAEGU Leptin OS=Taeniopygia guttata OX=59729 GN=LPN PE=2 SV=1
20	H9NAC2	5.84e-04	40.8	171	0.216	0.211	H9NAC2_SALAL Leptin OS=Salvelinus alpinus OX=8036 GN=cLepA1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02024 Leptin	7.7e-69	241.5	Leptin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330393	0.999	Leptin receptor
2	9606.ENSP00000335074	0.994	Appetite-regulating hormone
3	9606.ENSP00000387662	0.985	Glucagon
4	9606.ENSP00000240652	0.984	Islet amyloid polypeptide
5	9606.ENSP00000287820	0.984	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000264657	0.982	Signal transducer and activator of transcription 3
7	9606.ENSP00000330341	0.980	Suppressor of cytokine signaling 3
8	9606.ENSP00000371067	0.980	Tyrosine-protein kinase JAK2
9	9606.ENSP00000384364	0.977	Pro-neuropeptide Y
10	9606.ENSP00000360683	0.970	Tyrosine-protein phosphatase non-receptor type 1
11	9606.ENSP00000264867	0.968	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
12	9606.ENSP00000427514	0.968	CCAAT/enhancer-binding protein alpha
13	9606.ENSP00000379472	0.965	Cholecystokinin
14	9606.ENSP00000255030	0.956	C-reactive protein
15	9606.ENSP00000360290	0.948	5'-AMP-activated protein kinase catalytic subunit alpha-2
16	9606.ENSP00000302150	0.946	Prolactin
17	9606.ENSP00000380432	0.936	Insulin
18	9606.ENSP00000389814	0.932	Adiponectin
19	9606.ENSP00000419692	0.930	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000323867	0.929	5'-AMP-activated protein kinase subunit gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:1990460	0.548	leptin receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0048518	0.987	positive regulation of biological process
GO:0050896	0.986	response to stimulus
GO:0048522	0.980	positive regulation of cellular process
GO:0009987	0.972	cellular process
GO:0080090	0.963	regulation of primary metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0009893	0.956	positive regulation of metabolic process
GO:0048583	0.936	regulation of response to stimulus
GO:0048519	0.932	negative regulation of biological process
GO:0023051	0.932	regulation of signaling
GO:0010646	0.932	regulation of cell communication
GO:0042221	0.930	response to chemical
GO:0010033	0.920	response to organic substance
GO:0032501	0.919	multicellular organismal process
GO:0009966	0.917	regulation of signal transduction
GO:0051174	0.916	regulation of phosphorus metabolic process
GO:0051239	0.908	regulation of multicellular organismal process
GO:0031325	0.902	positive regulation of cellular metabolic process
GO:0051716	0.898	cellular response to stimulus
GO:0031326	0.897	regulation of cellular biosynthetic process
GO:0048523	0.894	negative regulation of cellular process
GO:0032502	0.893	developmental process
GO:0010468	0.888	regulation of gene expression
GO:0010647	0.887	positive regulation of cell communication
GO:0023056	0.886	positive regulation of signaling
GO:0048856	0.878	anatomical structure development
GO:0070887	0.861	cellular response to chemical stimulus
GO:0019216	0.861	regulation of lipid metabolic process
GO:0009725	0.861	response to hormone
GO:0019220	0.859	regulation of phosphate metabolic process
GO:1904892	0.855	regulation of receptor signaling pathway via STAT
GO:0032879	0.840	regulation of localization
GO:0009967	0.840	positive regulation of signal transduction
GO:0010562	0.839	positive regulation of phosphorus metabolic process
GO:0042325	0.838	regulation of phosphorylation
GO:0045834	0.837	positive regulation of lipid metabolic process
GO:0046425	0.837	regulation of receptor signaling pathway via JAK-STAT
GO:0062013	0.834	positive regulation of small molecule metabolic process
GO:1904894	0.834	positive regulation of receptor signaling pathway via STAT
GO:0019217	0.826	regulation of fatty acid metabolic process
GO:0046889	0.826	positive regulation of lipid biosynthetic process
GO:1901700	0.818	response to oxygen-containing compound
GO:0010604	0.817	positive regulation of macromolecule metabolic process
GO:0051171	0.813	regulation of nitrogen compound metabolic process
GO:0051240	0.813	positive regulation of multicellular organismal process
GO:0046427	0.812	positive regulation of receptor signaling pathway via JAK-STAT
GO:0071310	0.809	cellular response to organic substance
GO:0042327	0.805	positive regulation of phosphorylation
GO:1902533	0.804	positive regulation of intracellular signal transduction
GO:0048585	0.803	negative regulation of response to stimulus
GO:0001934	0.803	positive regulation of protein phosphorylation
GO:0032101	0.792	regulation of response to external stimulus
GO:0007165	0.792	signal transduction
GO:0009892	0.788	negative regulation of metabolic process
GO:0050793	0.782	regulation of developmental process
GO:0045923	0.780	positive regulation of fatty acid metabolic process
GO:0051049	0.757	regulation of transport
GO:0042304	0.748	regulation of fatty acid biosynthetic process
GO:0045723	0.743	positive regulation of fatty acid biosynthetic process
GO:0010628	0.721	positive regulation of gene expression
GO:0042127	0.700	regulation of cell population proliferation
GO:0032868	0.689	response to insulin
GO:0032107	0.688	regulation of response to nutrient levels
GO:0032098	0.687	regulation of appetite
GO:0065009	0.683	regulation of molecular function
GO:0032095	0.683	regulation of response to food
GO:0023057	0.682	negative regulation of signaling
GO:0010648	0.681	negative regulation of cell communication
GO:0050790	0.669	regulation of catalytic activity
GO:1900076	0.601	regulation of cellular response to insulin stimulus
GO:0046626	0.601	regulation of insulin receptor signaling pathway
GO:0014066	0.598	regulation of phosphatidylinositol 3-kinase signaling
GO:0071495	0.595	cellular response to endogenous stimulus
GO:0008152	0.585	metabolic process
GO:0071704	0.577	organic substance metabolic process
GO:0044238	0.574	primary metabolic process
GO:0014068	0.555	positive regulation of phosphatidylinositol 3-kinase signaling
GO:0044237	0.521	cellular metabolic process
GO:0007166	0.450	cell surface receptor signaling pathway
GO:0019219	0.428	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.414	regulation of macromolecule biosynthetic process
GO:0032870	0.384	cellular response to hormone stimulus
GO:0006950	0.372	response to stress
GO:0051179	0.348	localization
GO:0007275	0.346	multicellular organism development
GO:0006807	0.321	nitrogen compound metabolic process
GO:0051252	0.318	regulation of RNA metabolic process
GO:0006355	0.312	regulation of DNA-templated transcription
GO:0044093	0.300	positive regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.928	intracellular anatomical structure
GO:0005737	0.800	cytoplasm
GO:0043231	0.545	intracellular membrane-bounded organelle
GO:0016020	0.492	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]