StarFunc result for job id P41161

User Input

>input (510 residues)
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNY
CAYDRKPPSGFKPLTPPTTPLSPTHQNPLFPPPQATLPTSGHAPAAGPVQGVGPAPAPHS
LPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNR
PSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
VDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGP
PYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYD
KLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDT
LPLTHFEDSPAYLLDMDRCSSLPYAEGFAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AC56	0.266	0.266	2.865E-70	510	0.947	0.947	D4AC56.pdb.gz	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
2	AFDB:P41164	0.307	0.326	4.271E-48	477	0.608	0.650	P41164.pdb.gz	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
3	AFDB:B0S6S7	0.247	0.242	1.498E-47	524	0.653	0.635	B0S6S7.pdb.gz	B0S6S7_DANRE ETS translocation variant 5 isoform 1 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=1
4	AFDB:A0A2R8QC01	0.374	0.365	2.714E-47	526	0.629	0.610	A0A2R8QC01.pdb.gz	A0A2R8QC01_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
5	AFDB:Q9PUQ1	0.283	0.292	6.954E-38	494	0.492	0.508	Q9PUQ1.pdb.gz	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
6	AFDB:P51862	0.101	0.045	1.247E-2	1356	0.141	0.053	P51862.pdb.gz	ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROM2 PE=1 SV=1
7	AFDB:Q15398	0.089	0.056	2.755E-2	846	0.147	0.089	Q15398.pdb.gz	DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens OX=9606 GN=DLGAP5 PE=1 SV=2
8	AFDB:R9PY21	0.074	0.056	3.588E-2	720	0.149	0.106	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
9	AFDB:A8JNQ4	0.102	0.071	1.344E-1	796	0.151	0.097	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
10	AFDB:Q15424	0.077	0.049	1.344E-1	915	0.153	0.085	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
11	PDB:1ldjA	0.101	0.074	1.645E-1	725	0.018	0.012	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
12	PDB:1ft9A	0.111	0.234	2.981E-1	210	0.031	0.076	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
13	PDB:5k1yD	0.088	0.378	3.184E-1	92	0.022	0.120	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
14	PDB:6w6wC	0.089	0.125	3.882E-1	323	0.039	0.062	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:3m8eA	0.095	0.360	5.056E-1	101	0.022	0.109	3m8eA.pdb.gz
16	PDB:2xhkB	0.118	0.233	6.163E-1	217	0.031	0.074	2xhkB.pdb.gz	Structural Basis for the Regulation of Ntca-Dependent Transcription by Proteins Pipx and Pii.
17	PDB:1jhfA	0.081	0.200	7.514E-1	197	0.018	0.046	1jhfA.pdb.gz
18	PDB:2xv4S	0.090	0.111	7.514E-1	399	0.012	0.015	2xv4S.pdb.gz
19	PDB:5aj0BZ	0.082	0.353	7.514E-1	86	0.027	0.163	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
20	PDB:3cuqC	0.106	0.262	9.161E-1	173	0.016	0.046	3cuqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QC01	0.0	560	526	0.620	0.601	A0A2R8QC01_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
2	A0A8I6AQT3	0.0	937	528	0.945	0.913	A0A8I6AQT3_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
3	B0S6S7	0.0	599	524	0.667	0.649	B0S6S7_DANRE ETS translocation variant 5 isoform 1 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=1
4	D4AC56	0.0	948	510	0.947	0.947	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
5	F1Q6X6	0.0	605	522	0.667	0.651	F1Q6X6_DANRE ETS translocation variant 5 isoform 2 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=3
6	F1QK52	0.0	564	524	0.620	0.603	F1QK52_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
7	P41161	0.0	1045	510	1.000	1.000	ETV5_HUMAN ETS translocation variant 5 OS=Homo sapiens OX=9606 GN=ETV5 PE=1 SV=1
8	P41164	0.0	587	477	0.610	0.652	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
9	P50549	0.0	590	477	0.620	0.662	ETV1_HUMAN ETS translocation variant 1 OS=Homo sapiens OX=9606 GN=ETV1 PE=1 SV=2
10	Q9CXC9	0.0	976	510	0.955	0.955	ETV5_MOUSE ETS translocation variant 5 OS=Mus musculus OX=10090 GN=Etv5 PE=2 SV=1
11	Q9PUQ1	4.95e-141	417	494	0.522	0.538	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
12	P43268	2.72e-136	404	484	0.508	0.535	ETV4_HUMAN ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=3
13	P28322	5.18e-132	394	485	0.496	0.522	ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2
14	B7Z5F4	1.49e-117	354	430	0.457	0.542	B7Z5F4_HUMAN ETS variant transcription factor 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=1
15	Q8MRW5	2.22e-53	192	640	0.169	0.134	ET96B_DROME ETV5-related protein Ets96B OS=Drosophila melanogaster OX=7227 GN=Ets96B PE=2 SV=1
16	A0A590UJP9	1.71e-33	135	504	0.116	0.117	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1
17	P14921	4.97e-33	132	441	0.114	0.132	ETS1_HUMAN Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1
18	P41156	4.97e-33	132	441	0.114	0.132	ETS1_RAT Protein C-ets-1 OS=Rattus norvegicus OX=10116 GN=Ets1 PE=1 SV=1
19	P27577	5.00e-33	132	440	0.114	0.132	ETS1_MOUSE Protein C-ets-1 OS=Mus musculus OX=10090 GN=Ets1 PE=1 SV=2
20	P15036	2.43e-32	131	469	0.110	0.119	ETS2_HUMAN Protein C-ets-2 OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	2.6e-30	115.9	Ets-domain
2	PF04621 ETS_PEA3_N	7.2e-156	531.0	PEA3 subfamily ETS-domain transcription factor N terminal domain
3	PF00447 HSF_DNA-bind	3e+02	13.3	HSF-type DNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306894

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360266	0.934	Transcription factor AP-1
2	9606.ENSP00000356641	0.931	E3 ubiquitin-protein ligase RFWD2
3	9606.ENSP00000292303	0.907	C-C chemokine receptor type 5
4	9606.ENSP00000387211	0.905	Interleukin-18 receptor 1
5	9606.ENSP00000229135	0.903	Interferon gamma
6	9606.ENSP00000376134	0.902	Signal transducer and activator of transcription 4
7	9606.ENSP00000317985	0.901	Rho-associated protein kinase 2
8	9606.ENSP00000382697	0.901	Rho-associated protein kinase 1
9	9606.ENSP00000296456	0.803	Acylamino-acid-releasing enzyme
10	9606.ENSP00000451411	0.789	Double homeobox 4 like 7
11	9606.ENSP00000458065	0.789	Double homeobox protein 4
12	9606.ENSP00000456340	0.781	DET1 homolog
13	9606.ENSP00000485452	0.767	Double homeodomain protein DUX4-s
14	9606.ENSP00000362222	0.762	Serine/threonine-protein kinase 40
15	9606.ENSP00000363822	0.756	Androgen receptor
16	9606.ENSP00000281017	0.746	Transmembrane protein 18
17	9606.ENSP00000344967	0.703	Protein sprouty homolog 4
18	9606.ENSP00000293805	0.700	B-cell CLL/lymphoma 6 member B protein
19	9606.ENSP00000394390	0.687	BTB/POZ domain-containing protein KCTD15
20	9606.ENSP00000295448	0.682	Glucosamine-6-phosphate deaminase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:0003700	0.989	DNA-binding transcription factor activity
GO:1990837	0.915	sequence-specific double-stranded DNA binding
GO:0005515	0.820	protein binding
GO:0000976	0.676	transcription cis-regulatory region binding
GO:0000981	0.533	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.488	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0048522	0.971	positive regulation of cellular process
GO:0032501	0.960	multicellular organismal process
GO:0019222	0.949	regulation of metabolic process
GO:0032502	0.938	developmental process
GO:0048856	0.913	anatomical structure development
GO:0051171	0.821	regulation of nitrogen compound metabolic process
GO:0080090	0.817	regulation of primary metabolic process
GO:0060255	0.779	regulation of macromolecule metabolic process
GO:0031323	0.770	regulation of cellular metabolic process
GO:0050896	0.764	response to stimulus
GO:0007275	0.746	multicellular organism development
GO:0048519	0.741	negative regulation of biological process
GO:0009893	0.728	positive regulation of metabolic process
GO:0010468	0.727	regulation of gene expression
GO:0030154	0.694	cell differentiation
GO:0010604	0.689	positive regulation of macromolecule metabolic process
GO:0048731	0.683	system development
GO:0009889	0.612	regulation of biosynthetic process
GO:0019219	0.611	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.578	regulation of cellular biosynthetic process
GO:0010556	0.569	regulation of macromolecule biosynthetic process
GO:0051252	0.569	regulation of RNA metabolic process
GO:0006355	0.562	regulation of DNA-templated transcription
GO:0048513	0.554	animal organ development
GO:0009653	0.548	anatomical structure morphogenesis
GO:0048523	0.529	negative regulation of cellular process
GO:0031325	0.498	positive regulation of cellular metabolic process
GO:0051173	0.493	positive regulation of nitrogen compound metabolic process
GO:0051239	0.438	regulation of multicellular organismal process
GO:0042127	0.388	regulation of cell population proliferation
GO:0048468	0.375	cell development
GO:0051716	0.360	cellular response to stimulus
GO:0008152	0.346	metabolic process
GO:0045935	0.326	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.325	positive regulation of cellular biosynthetic process
GO:0051254	0.324	positive regulation of RNA metabolic process
GO:0010557	0.320	positive regulation of macromolecule biosynthetic process
GO:0044237	0.318	cellular metabolic process
GO:0006357	0.316	regulation of transcription by RNA polymerase II
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.629	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]