StarFunc result for job id P41180

User Input

>input (1078 residues)
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQP
RCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHEPLLPLQCGE
TDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7dtvA	0.615	0.823	0.000	779	0.722	0.999	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
2	AFDB:F1R4B8	0.782	0.885	0.000	946	0.665	0.758	F1R4B8.pdb.gz
3	AFDB:P35384	0.854	0.849	0.000	1085	0.937	0.931	P35384.pdb.gz	CASR_BOVIN Extracellular calcium-sensing receptor OS=Bos taurus OX=9913 GN=CASR PE=2 SV=1
4	AFDB:F1LQ12	0.607	0.774	2.092E-72	824	0.302	0.396	F1LQ12.pdb.gz	F1LQ12_RAT Vomeronasal 2 receptor, 46 OS=Rattus norvegicus OX=10116 GN=Vom2r44 PE=4 SV=4
5	AFDB:Q70VB1	0.644	0.738	2.551E-68	928	0.297	0.345	Q70VB1.pdb.gz	GPC6A_RAT G-protein coupled receptor family C group 6 member A OS=Rattus norvegicus OX=10116 GN=Gprc6a PE=1 SV=1
6	AFDB:Q5T6X5	0.658	0.759	1.612E-67	926	0.283	0.329	Q5T6X5.pdb.gz	GPC6A_HUMAN G-protein coupled receptor family C group 6 member A OS=Homo sapiens OX=9606 GN=GPRC6A PE=1 SV=1
7	AFDB:Q5U9X3	0.641	0.784	3.170E-66	867	0.278	0.346	Q5U9X3.pdb.gz	GPC6A_DANRE G-protein coupled receptor family C group 6 member A OS=Danio rerio OX=7955 GN=gprc6a PE=1 SV=1
8	AFDB:P91685	0.655	0.719	1.014E-63	976	0.251	0.278	P91685.pdb.gz	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2
9	AFDB:Q6TAC4	0.647	0.803	1.147E-61	855	0.251	0.317	Q6TAC4.pdb.gz	V2R26_MOUSE Vomeronasal type-2 receptor 26 OS=Mus musculus OX=10090 GN=Vmn2r26 PE=2 SV=2
10	AFDB:P31422	0.665	0.806	3.450E-60	879	0.261	0.320	P31422.pdb.gz	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
11	AFDB:P31421	0.671	0.819	1.984E-59	872	0.257	0.318	P31421.pdb.gz	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
12	PDB:7e9gR	0.589	0.798	4.370E-49	769	0.245	0.343	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
13	PDB:7epaA	0.536	0.703	1.237E-48	782	0.238	0.329	7epaA.pdb.gz
14	PDB:7e9hR	0.581	0.788	8.041E-46	766	0.239	0.337	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
15	PDB:7epcA	0.525	0.686	1.290E-45	782	0.226	0.312	7epcA.pdb.gz
16	PDB:7wihA	0.557	0.776	4.128E-43	741	0.240	0.350	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
17	PDB:7c7sA	0.309	0.414	1.472E-29	685	0.132	0.207	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
18	PDB:6w2xB	0.318	0.446	1.032E-24	669	0.130	0.209	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
19	PDB:4tllA	0.241	0.322	1.506E-14	767	0.083	0.117	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
20	PDB:4pe5C	0.250	0.340	1.735E-14	754	0.077	0.110	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E7K1	0.0	681	929	0.336	0.390	A8E7K1_DANRE Vomeronasal 2, receptor 1 OS=Danio rerio OX=7955 GN=v2rl1 PE=4 SV=1
2	F1LQ12	0.0	679	912	0.335	0.396	F1LQ12_RAT Vomeronasal 2 receptor, 46 OS=Rattus norvegicus OX=10116 GN=Vom2r44 PE=4 SV=4
3	O70410	0.0	665	912	0.330	0.390	V2R1_MOUSE Vomeronasal type-2 receptor 1 OS=Mus musculus OX=10090 GN=Vmn2r1 PE=1 SV=1
4	P35384	0.0	1946	1085	0.936	0.930	CASR_BOVIN Extracellular calcium-sensing receptor OS=Bos taurus OX=9913 GN=CASR PE=2 SV=1
5	P41180	0.0	2228	1078	1.000	1.000	CASR_HUMAN Extracellular calcium-sensing receptor OS=Homo sapiens OX=9606 GN=CASR PE=1 SV=3
6	P48442	0.0	1978	1079	0.936	0.935	CASR_RAT Extracellular calcium-sensing receptor OS=Rattus norvegicus OX=10116 GN=Casr PE=1 SV=1
7	Q9QY96	0.0	1964	1079	0.929	0.929	CASR_MOUSE Extracellular calcium-sensing receptor OS=Mus musculus OX=10090 GN=Casr PE=1 SV=2
8	Q70VB1	6.22e-165	512	928	0.309	0.359	GPC6A_RAT G-protein coupled receptor family C group 6 member A OS=Rattus norvegicus OX=10116 GN=Gprc6a PE=1 SV=1
9	Q8K4Z6	8.98e-164	509	928	0.295	0.343	GPC6A_MOUSE G-protein coupled receptor family C group 6 member A OS=Mus musculus OX=10090 GN=Gprc6a PE=1 SV=1
10	Q5T6X5	1.60e-155	488	926	0.290	0.338	GPC6A_HUMAN G-protein coupled receptor family C group 6 member A OS=Homo sapiens OX=9606 GN=GPRC6A PE=1 SV=1
11	Q5U9X3	1.57e-150	473	867	0.287	0.356	GPC6A_DANRE G-protein coupled receptor family C group 6 member A OS=Danio rerio OX=7955 GN=gprc6a PE=1 SV=1
12	Q6TAC4	1.50e-136	435	855	0.260	0.327	V2R26_MOUSE Vomeronasal type-2 receptor 26 OS=Mus musculus OX=10090 GN=Vmn2r26 PE=2 SV=2
13	A0A8V5KX69	6.62e-135	431	850	0.256	0.325	A0A8V5KX69_MOUSE Vomeronasal 2, receptor 120 OS=Mus musculus OX=10090 GN=Vmn2r120 PE=4 SV=1
14	A1L1T5	1.83e-132	426	905	0.273	0.325	A1L1T5_DANRE Glutamate receptor, metabotropic 6b OS=Danio rerio OX=7955 GN=cb496 PE=2 SV=1
15	E9PX34	5.28e-132	423	856	0.250	0.315	E9PX34_MOUSE Vomeronasal 2, receptor 120 OS=Mus musculus OX=10090 GN=Vmn2r120 PE=4 SV=1
16	Q9QYS2	1.01e-131	423	879	0.265	0.325	GRM3_MOUSE Metabotropic glutamate receptor 3 OS=Mus musculus OX=10090 GN=Grm3 PE=1 SV=1
17	Q9Z0R8	2.11e-131	421	840	0.245	0.314	TS1R1_RAT Taste receptor type 1 member 1 OS=Rattus norvegicus OX=10116 GN=Tas1r1 PE=2 SV=1
18	P31423	2.75e-131	423	912	0.256	0.303	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
19	Q14832	4.83e-131	421	879	0.267	0.328	GRM3_HUMAN Metabotropic glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRM3 PE=1 SV=2
20	Q68EF4	5.41e-131	422	912	0.255	0.302	GRM4_MOUSE Metabotropic glutamate receptor 4 OS=Mus musculus OX=10090 GN=Grm4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	1e-64	230.3	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF01094 ANF_receptor	2.2e-103	357.8	Receptor family ligand binding region
3	PF07699 Ephrin_rec_like	14	16.8	Tyrosine-protein kinase ephrin type A/B receptor-like
4	PF07562 NCD3G	1.2e-13	62.0	Nine Cysteines Domain of family 3 GPCR
5	PF13458 Peripla_BP_6	1.6e-06	39.7	Periplasmic binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420194

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358866	0.988	Filamin-A
2	9606.ENSP00000286548	0.985	Guanine nucleotide-binding protein G(q) subunit alpha
3	9606.ENSP00000354896	0.980	Metabotropic glutamate receptor 1
4	9606.ENSP00000366233	0.955	Gamma-aminobutyric acid type B receptor subunit 1
5	9606.ENSP00000306138	0.928	Metabotropic glutamate receptor 5
6	9606.ENSP00000078429	0.921	Guanine nucleotide-binding protein subunit alpha-11
7	9606.ENSP00000282091	0.913	Parathyroid hormone
8	9606.ENSP00000346671	0.913	Tyrosine-protein kinase Fyn
9	9606.ENSP00000343027	0.856	Guanine nucleotide-binding protein G(i) subunit alpha-1
10	9606.ENSP00000260402	0.851	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
11	9606.ENSP00000309493	0.831	G-protein coupled receptor family C group 6 member A
12	9606.ENSP00000443631	0.825	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
13	9606.ENSP00000338185	0.823	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
14	9606.ENSP00000312999	0.807	Guanine nucleotide-binding protein G(i) subunit alpha-2
15	9606.ENSP00000367762	0.807	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
16	9606.ENSP00000358867	0.803	Guanine nucleotide-binding protein G(k) subunit alpha
17	9606.ENSP00000249284	0.802	Taste receptor type 2 member 16
18	9606.ENSP00000368805	0.782	Chorion-specific transcription factor GCMb
19	9606.ENSP00000386210	0.774	Taste receptor type 2 member 40
20	9606.ENSP00000265310	0.771	Transient receptor potential cation channel subfamily V member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0004930	0.996	G protein-coupled receptor activity
GO:0043168	0.519	anion binding
GO:0008066	0.307	glutamate receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0065007	0.985	biological regulation
GO:0009987	0.984	cellular process
GO:0050789	0.984	regulation of biological process
GO:0032501	0.975	multicellular organismal process
GO:0050794	0.971	regulation of cellular process
GO:0055080	0.947	monoatomic cation homeostasis
GO:0098771	0.945	inorganic ion homeostasis
GO:0023052	0.943	signaling
GO:0007154	0.943	cell communication
GO:0055074	0.927	calcium ion homeostasis
GO:0032502	0.897	developmental process
GO:0051716	0.897	cellular response to stimulus
GO:0048856	0.852	anatomical structure development
GO:0007165	0.844	signal transduction
GO:0055082	0.828	intracellular chemical homeostasis
GO:0006811	0.827	monoatomic ion transport
GO:0051924	0.803	regulation of calcium ion transport
GO:0048518	0.793	positive regulation of biological process
GO:0042221	0.765	response to chemical
GO:0010033	0.656	response to organic substance
GO:1901700	0.593	response to oxygen-containing compound
GO:0006874	0.544	intracellular calcium ion homeostasis
GO:0030001	0.541	metal ion transport
GO:0007186	0.536	G protein-coupled receptor signaling pathway
GO:0019222	0.494	regulation of metabolic process
GO:0048522	0.451	positive regulation of cellular process
GO:0065009	0.409	regulation of molecular function
GO:0071702	0.405	organic substance transport
GO:0003008	0.303	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.832	intracellular anatomical structure
GO:0043227	0.748	membrane-bounded organelle
GO:0043229	0.719	intracellular organelle
GO:0005737	0.596	cytoplasm
GO:0043231	0.471	intracellular membrane-bounded organelle
GO:0120025	0.387	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]