StarFunc result for job id P41182

User Input

>input (706 residues)
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41183	0.414	0.413	1.598E-93	707	0.948	0.946	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
2	AFDB:F1R5N6	0.378	0.372	1.219E-57	718	0.606	0.596	F1R5N6.pdb.gz	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
3	AFDB:A0A2R8Q3C5	0.201	0.210	1.474E-46	672	0.557	0.585	A0A2R8Q3C5.pdb.gz
4	AFDB:A8DYD1	0.185	0.160	1.319E-18	837	0.147	0.124	A8DYD1.pdb.gz	A8DYD1_DROME Combgap, isoform L OS=Drosophila melanogaster OX=7227 GN=cg PE=1 SV=2
5	AFDB:F1RAC1	0.158	0.108	7.855E-18	1146	0.195	0.120	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
6	AFDB:E9PEP7	0.137	0.129	1.526E-13	755	0.169	0.158	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
7	AFDB:A0A024RC04	0.163	0.148	3.789E-12	805	0.160	0.140	A0A024RC04.pdb.gz
8	AFDB:A0A0A0MT54	0.161	0.214	6.698E-10	522	0.170	0.230	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
9	AFDB:R9PY21	0.120	0.118	1.663E-8	720	0.133	0.131	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
10	AFDB:O15209	0.110	0.121	2.239E-8	634	0.166	0.185	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
11	PDB:3w5kB	0.073	0.247	4.310E-4	110	0.050	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ad8D	0.037	0.072	1.176	280	0.027	0.068	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
13	PDB:4kfzB	0.049	0.157	2.131	148	0.035	0.169	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
14	PDB:5dkaA	0.042	0.239	2.262	96	0.023	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
15	PDB:6gejS	0.043	0.110	3.232	208	0.044	0.149	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:5vztA	0.055	0.224	3.641	145	0.016	0.076	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
17	PDB:7zsb4	0.028	0.054	3.864	306	0.017	0.039	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
18	PDB:3ogkA	0.065	0.253	4.100	145	0.014	0.069	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
19	PDB:6nmiC	0.050	0.072	4.902	408	0.024	0.042	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
20	PDB:7qo48	0.059	0.090	5.202	372	0.014	0.027	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R5N6	0.0	840	718	0.622	0.611	F1R5N6_DANRE B-cell lymphoma 6 protein isoform X2 OS=Danio rerio OX=7955 GN=bcl6 PE=4 SV=1
2	P41182	0.0	1461	706	1.000	1.000	BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens OX=9606 GN=BCL6 PE=1 SV=1
3	P41183	0.0	1368	707	0.948	0.946	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
4	Q6PC08	0.0	840	704	0.622	0.624	Q6PC08_DANRE B-cell CLL/lymphoma 6 (Zinc finger protein 51) OS=Danio rerio OX=7955 GN=bcl6 PE=2 SV=1
5	O88282	4.21e-91	294	474	0.186	0.276	BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus OX=10090 GN=Bcl6b PE=1 SV=1
6	Q8N143	1.86e-90	292	479	0.191	0.282	BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens OX=9606 GN=BCL6B PE=2 SV=2
7	A8KA13	1.92e-90	292	480	0.191	0.281	A8KA13_HUMAN B-cell CLL/lymphoma 6, member B (Zinc finger protein), isoform CRA_a OS=Homo sapiens OX=9606 GN=BCL6B PE=1 SV=1
8	Q03923	8.14e-45	171	595	0.132	0.156	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	Q49A12	9.08e-45	170	536	0.132	0.174	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
10	Q8WV37	5.18e-44	168	535	0.133	0.176	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
11	F8WEZ9	5.59e-44	167	492	0.133	0.191	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
12	Q9H8G1	1.45e-43	167	570	0.113	0.140	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
13	Q2NKJ9	1.47e-43	167	569	0.113	0.141	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
14	Q16600	2.62e-43	164	458	0.133	0.205	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3
15	Q5TYW1	3.47e-43	170	1059	0.129	0.086	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
16	Q86WZ6	3.70e-43	169	799	0.132	0.116	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
17	P17020	8.65e-43	167	682	0.112	0.116	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
18	Q5JVG8	1.35e-42	162	444	0.115	0.182	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
19	Q3TN43	2.33e-42	164	591	0.115	0.137	Q3TN43_MOUSE Zinc finger protein 386 (Kruppel-like) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
20	P51522	2.58e-42	163	516	0.113	0.155	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	2.9e-24	96.8	BTB/POZ domain
2	PF12773 DZR	0.016	26.5	Double zinc ribbon
3	PF00096 zf-C2H2	1.9e-15	67.5	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	2.2e-07	42.1	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.4e+02	13.9	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	0.026	26.1	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	0.57	22.0	C2HE / C2H2 / C2HC zinc-binding finger
8	PF13465 zf-H2C2_2	3.3e-17	73.3	Zinc-finger double domain
9	PF12874 zf-met	3.1e-07	41.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268712	0.999	Nuclear receptor corepressor 1
2	9606.ENSP00000367705	0.999	BCL-6 corepressor
3	9606.ENSP00000384018	0.999	Nuclear receptor corepressor 2
4	9606.ENSP00000370343	0.991	Interferon regulatory factor 4
5	9606.ENSP00000177694	0.989	T-box transcription factor TBX21
6	9606.ENSP00000383973	0.988	Metastasis-associated protein MTA3
7	9606.ENSP00000225983	0.984	Histone deacetylase 5
8	9606.ENSP00000264657	0.979	Signal transducer and activator of transcription 3
9	9606.ENSP00000221972	0.976	B-cell antigen receptor complex-associated protein alpha chain
10	9606.ENSP00000479618	0.975	Myc proto-oncogene protein
11	9606.ENSP00000269305	0.973	Cellular tumor antigen p53
12	9606.ENSP00000212015	0.967	NAD-dependent protein deacetylase sirtuin-1
13	9606.ENSP00000411355	0.967	Receptor-type tyrosine-protein phosphatase C
14	9606.ENSP00000437940	0.967	B-lymphocyte antigen CD19
15	9606.ENSP00000264606	0.966	Histone deacetylase 4
16	9606.ENSP00000286639	0.966	Basic leucine zipper transcriptional factor ATF-like
17	9606.ENSP00000227507	0.965	G1/S-specific cyclin-D1
18	9606.ENSP00000362649	0.965	Histone deacetylase 1
19	9606.ENSP00000335153	0.962	Heat shock protein HSP 90-alpha
20	9606.ENSP00000368880	0.961	Forkhead box protein O1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0000977	0.946	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0031490	0.934	chromatin DNA binding
GO:0000978	0.928	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001161	0.523	intronic transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0051172	0.977	negative regulation of nitrogen compound metabolic process
GO:0048523	0.971	negative regulation of cellular process
GO:0031324	0.959	negative regulation of cellular metabolic process
GO:0010605	0.942	negative regulation of macromolecule metabolic process
GO:0045934	0.919	negative regulation of nucleobase-containing compound metabolic process
GO:0009987	0.918	cellular process
GO:0050896	0.889	response to stimulus
GO:0032502	0.886	developmental process
GO:0032501	0.883	multicellular organismal process
GO:0048856	0.881	anatomical structure development
GO:0048518	0.878	positive regulation of biological process
GO:0009890	0.865	negative regulation of biosynthetic process
GO:0048583	0.863	regulation of response to stimulus
GO:0045892	0.859	negative regulation of DNA-templated transcription
GO:0048522	0.847	positive regulation of cellular process
GO:0043066	0.798	negative regulation of apoptotic process
GO:0010646	0.747	regulation of cell communication
GO:0051716	0.682	cellular response to stimulus
GO:0023051	0.677	regulation of signaling
GO:0006357	0.664	regulation of transcription by RNA polymerase II
GO:0009966	0.652	regulation of signal transduction
GO:0007275	0.639	multicellular organism development
GO:0009893	0.590	positive regulation of metabolic process
GO:0010604	0.583	positive regulation of macromolecule metabolic process
GO:0071704	0.547	organic substance metabolic process
GO:0044238	0.540	primary metabolic process
GO:1902531	0.519	regulation of intracellular signal transduction
GO:0000122	0.507	negative regulation of transcription by RNA polymerase II
GO:0006807	0.501	nitrogen compound metabolic process
GO:0051239	0.473	regulation of multicellular organismal process
GO:0002376	0.459	immune system process
GO:0043170	0.454	macromolecule metabolic process
GO:0048585	0.434	negative regulation of response to stimulus
GO:0051173	0.434	positive regulation of nitrogen compound metabolic process
GO:0042127	0.421	regulation of cell population proliferation
GO:0002682	0.420	regulation of immune system process
GO:0023052	0.411	signaling
GO:0007154	0.407	cell communication
GO:0031325	0.403	positive regulation of cellular metabolic process
GO:0006950	0.397	response to stress
GO:0002684	0.397	positive regulation of immune system process
GO:0048731	0.390	system development
GO:0065009	0.378	regulation of molecular function
GO:0007165	0.364	signal transduction
GO:0010648	0.361	negative regulation of cell communication
GO:0051240	0.353	positive regulation of multicellular organismal process
GO:0044237	0.352	cellular metabolic process
GO:0045935	0.345	positive regulation of nucleobase-containing compound metabolic process
GO:0051246	0.338	regulation of protein metabolic process
GO:0048584	0.324	positive regulation of response to stimulus
GO:0031399	0.320	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.978	nucleoplasm
GO:0005737	0.778	cytoplasm
GO:0016020	0.369	membrane
GO:0043232	0.332	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]