StarFunc result for job id P41217

User Input

>input (278 residues)
MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
LSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41217	1.000	1.000	4.175E-49	278	1.000	1.000	P41217.pdb.gz	OX2G_HUMAN OX-2 membrane glycoprotein OS=Homo sapiens OX=9606 GN=CD200 PE=1 SV=4
2	AFDB:O54901	0.826	0.826	1.155E-40	278	0.770	0.770	O54901.pdb.gz	OX2G_MOUSE OX-2 membrane glycoprotein OS=Mus musculus OX=10090 GN=Cd200 PE=1 SV=1
3	AFDB:Q9JLB9	0.651	0.346	2.713E-18	549	0.194	0.098	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
4	AFDB:Q15223	0.628	0.353	5.271E-17	517	0.183	0.099	Q15223.pdb.gz	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
5	AFDB:K4PZ75	0.667	0.385	1.543E-16	510	0.176	0.096	K4PZ75.pdb.gz	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
6	AFDB:B0CLW6	0.614	0.529	5.005E-16	328	0.162	0.137	B0CLW6.pdb.gz	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1
7	AFDB:Q8BVF6	0.619	0.441	2.707E-15	408	0.219	0.150	Q8BVF6.pdb.gz	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
8	AFDB:A2CG22	0.481	0.278	5.264E-15	539	0.169	0.087	A2CG22.pdb.gz	A2CG22_MOUSE Butyrophilin-like 6 OS=Mus musculus OX=10090 GN=Btnl6 PE=1 SV=1
9	AFDB:Q7TST0	0.545	0.321	5.540E-15	509	0.223	0.122	Q7TST0.pdb.gz	BTNL1_MOUSE Butyrophilin-like protein 1 OS=Mus musculus OX=10090 GN=Btnl1 PE=2 SV=3
10	AFDB:P32507	0.642	0.357	6.798E-15	530	0.198	0.104	P32507.pdb.gz	NECT2_MOUSE Nectin-2 OS=Mus musculus OX=10090 GN=Nectin2 PE=1 SV=2
11	PDB:2qhrL	0.337	0.405	2.187E-12	218	0.147	0.188	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
12	PDB:1ngwH	0.336	0.418	5.217E-12	216	0.151	0.194	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
13	PDB:4fqqL	0.318	0.402	1.124E-11	213	0.147	0.192	4fqqL.pdb.gz
14	PDB:3c2aL	0.344	0.433	1.310E-11	216	0.144	0.185	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
15	PDB:4adfM	0.547	0.760	2.076E-11	191	0.126	0.183	4adfM.pdb.gz
16	PDB:1aqkL	0.370	0.465	4.472E-11	216	0.147	0.190	1aqkL.pdb.gz
17	PDB:1a8jL	0.348	0.437	6.397E-11	216	0.147	0.190	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
18	PDB:6vpyL	0.311	0.398	8.261E-11	209	0.140	0.187	6vpyL.pdb.gz
19	PDB:4lluB	0.350	0.448	8.695E-11	210	0.129	0.171	4lluB.pdb.gz
20	PDB:3tygL	0.344	0.445	9.151E-11	207	0.140	0.188	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41217	0.0	576	278	1.000	1.000	OX2G_HUMAN OX-2 membrane glycoprotein OS=Homo sapiens OX=9606 GN=CD200 PE=1 SV=4
2	O54901	5.58e-147	414	278	0.770	0.770	OX2G_MOUSE OX-2 membrane glycoprotein OS=Mus musculus OX=10090 GN=Cd200 PE=1 SV=1
3	P04218	1.28e-144	409	278	0.759	0.759	OX2G_RAT OX-2 membrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Cd200 PE=2 SV=1
4	A0A8I5ZLI7	6.07e-13	70.5	447	0.183	0.114	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1
5	Q9JKF6	8.29e-13	70.1	515	0.209	0.113	NECT1_MOUSE Nectin-1 OS=Mus musculus OX=10090 GN=Nectin1 PE=1 SV=3
6	Q9JLB9	9.41e-13	70.1	549	0.173	0.087	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
7	F1LNP8	1.01e-12	70.1	515	0.209	0.113	F1LNP8_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=2
8	A0A8I5ZU75	1.30e-12	69.7	549	0.180	0.091	A0A8I5ZU75_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
9	D4A5C0	1.40e-12	69.7	528	0.180	0.095	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2
10	Q9NQS3	1.77e-12	69.3	549	0.173	0.087	NECT3_HUMAN Nectin-3 OS=Homo sapiens OX=9606 GN=NECTIN3 PE=1 SV=1
11	A0A8I6APZ5	1.84e-12	68.9	438	0.180	0.114	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
12	Q9GL76	1.96e-12	69.3	515	0.209	0.113	NECT1_PIG Nectin-1 OS=Sus scrofa OX=9823 GN=NECTIN1 PE=1 SV=1
13	Q15223	5.15e-12	67.8	517	0.180	0.097	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
14	Q8BVF6	7.02e-10	61.2	408	0.191	0.130	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
15	Q8K094	7.48e-10	61.2	408	0.191	0.130	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
16	Q91WP1	7.55e-10	61.2	408	0.191	0.130	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
17	K4PZ75	3.54e-08	56.2	510	0.155	0.084	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
18	Q96NY8	3.54e-08	56.2	510	0.155	0.084	NECT4_HUMAN Nectin-4 OS=Homo sapiens OX=9606 GN=NECTIN4 PE=1 SV=1
19	P15151	2.48e-07	53.5	417	0.165	0.110	PVR_HUMAN Poliovirus receptor OS=Homo sapiens OX=9606 GN=PVR PE=1 SV=2
20	B0CLW6	5.08e-07	52.4	328	0.173	0.146	B0CLW6_DANRE PVR cell adhesion molecule related 2 like precursor OS=Danio rerio OX=7955 GN=si:dkey-225e11.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	75	15.1	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	1.6	20.2	CD80-like C2-set immunoglobulin domain
3	PF10101 DUF2339	2.8e+02	11.5	Predicted membrane protein (DUF2339)
4	PF07679 I-set	0.0063	27.9	Immunoglobulin I-set domain
5	PF00047 ig	1.4e-19	81.4	Immunoglobulin domain
6	PF13895 Ig_2	3.3	19.4	Immunoglobulin domain
7	PF13927 Ig_3	5.1e-07	41.5	Immunoglobulin domain
8	PF20479 TMEM128	60	15.6	TMEM128 protein
9	PF07686 V-set	0.00059	31.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008977041.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003825146.1	0.991	Cell surface glycoprotein CD200 receptor 1
2	9597.XP_003825145.1	0.958	Cell surface glycoprotein CD200 receptor 2 isoform X1
3	9597.XP_003827334.1	0.693	CD226 antigen
4	9597.XP_003823793.1	0.689	C-X3-C motif chemokine ligand 1
5	9597.XP_003818350.1	0.613	Translin
6	9597.XP_008972991.1	0.557	Tyrosine-protein phosphatase non-receptor type substrate 1
7	9597.XP_008954688.1	0.554	Belongs to the intermediate filament family.
8	9597.XP_003825276.1	0.550	CD47 molecule
9	9597.XP_003826121.1	0.541	Belongs to the G-protein coupled receptor 1 family.
10	9597.XP_008962298.1	0.536	Leucine rich repeats and immunoglobulin like domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051241	0.995	negative regulation of multicellular organismal process
GO:0048523	0.994	negative regulation of cellular process
GO:0002682	0.992	regulation of immune system process
GO:0009987	0.988	cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0001817	0.966	regulation of cytokine production
GO:0002683	0.947	negative regulation of immune system process
GO:0050865	0.926	regulation of cell activation
GO:0050727	0.922	regulation of inflammatory response
GO:0002694	0.921	regulation of leukocyte activation
GO:0048518	0.859	positive regulation of biological process
GO:0032102	0.857	negative regulation of response to external stimulus
GO:0050866	0.839	negative regulation of cell activation
GO:0002695	0.816	negative regulation of leukocyte activation
GO:0007155	0.786	cell adhesion
GO:0050728	0.769	negative regulation of inflammatory response
GO:0009893	0.507	positive regulation of metabolic process
GO:0048522	0.498	positive regulation of cellular process
GO:0050896	0.493	response to stimulus
GO:0080090	0.484	regulation of primary metabolic process
GO:0051171	0.484	regulation of nitrogen compound metabolic process
GO:0031323	0.480	regulation of cellular metabolic process
GO:0010604	0.472	positive regulation of macromolecule metabolic process
GO:0042127	0.441	regulation of cell population proliferation
GO:0051240	0.435	positive regulation of multicellular organismal process
GO:0098609	0.403	cell-cell adhesion
GO:0065009	0.380	regulation of molecular function
GO:0032879	0.369	regulation of localization
GO:0044093	0.313	positive regulation of molecular function
GO:0010628	0.311	positive regulation of gene expression
GO:0051049	0.309	regulation of transport
GO:0010941	0.307	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009986	1.000	cell surface
GO:0005886	0.985	plasma membrane
GO:0044297	0.749	cell body
GO:0042995	0.718	cell projection
GO:0120025	0.712	plasma membrane bounded cell projection
GO:0043025	0.688	neuronal cell body
GO:0043226	0.651	organelle
GO:0043227	0.566	membrane-bounded organelle
GO:0005622	0.529	intracellular anatomical structure
GO:0043005	0.448	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]