StarFunc result for job id P41221

User Input

>input (380 residues)
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P22725	0.993	0.993	9.972E-68	380	0.987	0.987	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
2	AFDB:P31286	0.929	0.929	2.483E-61	380	0.855	0.855	P31286.pdb.gz	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
3	AFDB:Q9YGX6	0.913	0.901	4.349E-61	385	0.900	0.888	Q9YGX6.pdb.gz	Q9YGX6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5A PE=2 SV=1
4	AFDB:Q92050	0.921	0.964	3.086E-57	363	0.774	0.810	Q92050.pdb.gz	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
5	AFDB:B1WBR9	0.920	0.939	7.722E-57	372	0.771	0.788	B1WBR9.pdb.gz	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
6	AFDB:A1BPR0	0.912	0.926	2.470E-55	374	0.718	0.730	A1BPR0.pdb.gz	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
7	AFDB:Q3L255	0.877	0.927	3.908E-55	359	0.763	0.808	Q3L255.pdb.gz	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
8	AFDB:Q98SN7	0.798	0.788	1.503E-40	385	0.492	0.486	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
9	AFDB:P34889	0.845	0.889	3.198E-39	360	0.389	0.411	P34889.pdb.gz	WNT2_CAEEL Protein Wnt-2 OS=Caenorhabditis elegans OX=6239 GN=cwn-2 PE=1 SV=2
10	AFDB:Q93097	0.760	0.739	7.226E-39	391	0.466	0.453	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
11	PDB:6ahyB	0.705	0.845	7.740E-31	313	0.389	0.473	6ahyB.pdb.gz
12	PDB:4f0aB	0.622	0.786	2.897E-24	294	0.324	0.418	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6xywBd	0.077	0.115	1.888	216	0.042	0.074	6xywBd.pdb.gz	Cryo-EM structure of the RNA-rich plant mitochondrial ribosome.
14	PDB:4b2tq	0.126	0.132	2.200	359	0.058	0.061	4b2tq.pdb.gz
15	PDB:7w2zR	0.130	0.149	2.436	301	0.061	0.076	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
16	PDB:7we4A	0.083	0.037	2.436	1122	0.061	0.020	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
17	PDB:4w8yA	0.159	0.083	2.697	835	0.047	0.022	4w8yA.pdb.gz	Structural Model of a CRISPR RNA-Silencing Complex Reveals the RNA-Target Cleavage Activity in Cmr4.
18	PDB:7nfeA	0.116	0.026	2.838	3585	0.050	0.005	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
19	PDB:6tmfd	0.090	0.066	3.143	582	0.063	0.041	6tmfd.pdb.gz	Molecular analysis of the ribosome recycling factor ABCE1 bound to the 30S post-splitting complex.
20	PDB:6sb3A	0.053	0.037	3.307	604	0.008	0.005	6sb3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1BPR0	0.0	585	374	0.713	0.725	A1BPR0_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt5a PE=2 SV=1
2	B1WBR9	0.0	617	372	0.771	0.788	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
3	P22725	0.0	786	380	0.987	0.987	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
4	P22726	0.0	619	359	0.753	0.797	WNT5B_MOUSE Protein Wnt-5b OS=Mus musculus OX=10090 GN=Wnt5b PE=1 SV=2
5	P31286	0.0	669	380	0.850	0.850	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
6	P41221	0.0	795	380	1.000	1.000	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
7	Q3L255	0.0	619	359	0.753	0.797	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
8	Q92050	0.0	631	363	0.774	0.810	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
9	Q9H1J7	0.0	617	359	0.750	0.794	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
10	Q9QXQ7	0.0	784	380	0.984	0.984	WNT5A_RAT Protein Wnt-5a OS=Rattus norvegicus OX=10116 GN=Wnt5a PE=2 SV=2
11	Q9YGX6	0.0	721	385	0.900	0.888	Q9YGX6_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5A PE=2 SV=1
12	Q98SN7	6.39e-127	372	385	0.505	0.499	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
13	Q8AY89	3.87e-120	355	387	0.463	0.455	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
14	Q1L130	6.74e-120	354	396	0.461	0.442	Q1L130_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2bb PE=2 SV=1
15	P47793	1.99e-117	347	352	0.466	0.503	WNT4A_DANRE Protein Wnt-4a OS=Danio rerio OX=7955 GN=wnt4a PE=2 SV=1
16	Q93097	2.20e-117	348	391	0.450	0.437	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
17	P49337	3.18e-117	346	351	0.466	0.504	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
18	P56705	3.62e-117	346	351	0.458	0.496	WNT4_HUMAN Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4
19	O70283	6.32e-117	347	389	0.447	0.437	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
20	P49338	1.59e-116	344	351	0.458	0.496	WNT4_XENLA Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	1.7e-119	410.5	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000015420

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000015796	0.987	Receptor-like tyrosine kinase
2	9601.ENSPPYP00000004289	0.977	Frizzled class receptor 4
3	9601.ENSPPYP00000009362	0.975	Frizzled class receptor 2
4	9601.ENSPPYP00000014662	0.971	Frizzled class receptor 5
5	9601.ENSPPYP00000020708	0.971	Frizzled class receptor 3
6	9601.ENSPPYP00000014616	0.967	Frizzled class receptor 7
7	9601.ENSPPYP00000024153	0.963	annotation not available
8	9601.ENSPPYP00000019980	0.950	Frizzled class receptor 1
9	9601.ENSPPYP00000021096	0.938	Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve inter [...]
10	9601.ENSPPYP00000019620	0.934	Frizzled class receptor 9
11	9601.ENSPPYP00000021705	0.934	Receptor tyrosine kinase-like orphan receptor 2
12	9601.ENSPPYP00000004719	0.927	Protein Wnt-5b
13	9601.ENSPPYP00000022733	0.915	Porcupine homolog (Drosophila)
14	9601.ENSPPYP00000001486	0.903	Receptor tyrosine kinase-like orphan receptor 1
15	9601.ENSPPYP00000002950	0.903	Secreted frizzled-related protein 5
16	9601.ENSPPYP00000005391	0.901	WNT inhibitory factor 1
17	9601.ENSPPYP00000002828	0.891	Pongo abelii dickkopf-related protein 1-like (LOC100435550), mRNA
18	9601.ENSPPYP00000008887	0.885	Dishevelled segment polarity protein 2
19	9601.ENSPPYP00000001456	0.871	Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins. Plays also an important role in establishment of the anterior-posterior body axis formation during development (By similarity)
20	9601.ENSPPYP00000002325	0.867	Dishevelled segment polarity protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0140677	0.960	molecular function activator activity
GO:0005109	0.957	frizzled binding
GO:0048018	0.949	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.979	multicellular organismal process
GO:0050896	0.977	response to stimulus
GO:0048856	0.977	anatomical structure development
GO:0009987	0.976	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0007154	0.963	cell communication
GO:0048522	0.962	positive regulation of cellular process
GO:0023052	0.959	signaling
GO:0007275	0.943	multicellular organism development
GO:0080090	0.938	regulation of primary metabolic process
GO:0031323	0.933	regulation of cellular metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0016055	0.915	Wnt signaling pathway
GO:0040012	0.912	regulation of locomotion
GO:0048731	0.900	system development
GO:0050793	0.885	regulation of developmental process
GO:0048513	0.878	animal organ development
GO:0009889	0.874	regulation of biosynthetic process
GO:0030111	0.857	regulation of Wnt signaling pathway
GO:0030335	0.848	positive regulation of cell migration
GO:0009653	0.846	anatomical structure morphogenesis
GO:0010556	0.835	regulation of macromolecule biosynthetic process
GO:0009888	0.833	tissue development
GO:0030154	0.831	cell differentiation
GO:0031325	0.827	positive regulation of cellular metabolic process
GO:0090090	0.827	negative regulation of canonical Wnt signaling pathway
GO:0051173	0.826	positive regulation of nitrogen compound metabolic process
GO:0043408	0.826	regulation of MAPK cascade
GO:0010628	0.826	positive regulation of gene expression
GO:0019219	0.823	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.819	regulation of cellular biosynthetic process
GO:0006355	0.807	regulation of DNA-templated transcription
GO:0045597	0.806	positive regulation of cell differentiation
GO:1902533	0.772	positive regulation of intracellular signal transduction
GO:0050678	0.767	regulation of epithelial cell proliferation
GO:0051128	0.761	regulation of cellular component organization
GO:0051239	0.760	regulation of multicellular organismal process
GO:0042060	0.752	wound healing
GO:0051093	0.746	negative regulation of developmental process
GO:0022603	0.743	regulation of anatomical structure morphogenesis
GO:0035567	0.741	non-canonical Wnt signaling pathway
GO:0008284	0.737	positive regulation of cell population proliferation
GO:0009719	0.732	response to endogenous stimulus
GO:0042221	0.718	response to chemical
GO:0065008	0.699	regulation of biological quality
GO:0051240	0.675	positive regulation of multicellular organismal process
GO:0050679	0.672	positive regulation of epithelial cell proliferation
GO:0007399	0.597	nervous system development
GO:0001654	0.580	eye development
GO:0060429	0.574	epithelium development
GO:0043010	0.570	camera-type eye development
GO:0009887	0.565	animal organ morphogenesis
GO:0065009	0.513	regulation of molecular function
GO:0009790	0.467	embryo development
GO:0009891	0.465	positive regulation of biosynthetic process
GO:0016477	0.461	cell migration
GO:0010557	0.453	positive regulation of macromolecule biosynthetic process
GO:0045935	0.452	positive regulation of nucleobase-containing compound metabolic process
GO:0048729	0.426	tissue morphogenesis
GO:0002009	0.391	morphogenesis of an epithelium
GO:0060070	0.373	canonical Wnt signaling pathway
GO:0071840	0.372	cellular component organization or biogenesis
GO:0048598	0.358	embryonic morphogenesis
GO:0007389	0.336	pattern specification process
GO:2000026	0.330	regulation of multicellular organismal development
GO:0016043	0.326	cellular component organization
GO:0009892	0.322	negative regulation of metabolic process
GO:0051246	0.322	regulation of protein metabolic process
GO:0010033	0.321	response to organic substance
GO:0045893	0.320	positive regulation of DNA-templated transcription
GO:0060322	0.300	head development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0071944	0.997	cell periphery
GO:0070013	0.996	intracellular organelle lumen
GO:0043227	0.989	membrane-bounded organelle
GO:0012505	0.986	endomembrane system
GO:0016020	0.985	membrane
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005615	0.941	extracellular space
GO:0032991	0.897	protein-containing complex
GO:0031982	0.895	vesicle
GO:0005886	0.894	plasma membrane
GO:0030054	0.787	cell junction
GO:0045202	0.672	synapse
GO:0030312	0.625	external encapsulating structure
GO:0031012	0.609	extracellular matrix
GO:0031090	0.598	organelle membrane
GO:0031410	0.576	cytoplasmic vesicle
GO:0005783	0.501	endoplasmic reticulum
GO:0005788	0.471	endoplasmic reticulum lumen
GO:0031981	0.343	nuclear lumen
GO:0098588	0.318	bounding membrane of organelle
GO:0062023	0.317	collagen-containing extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]