StarFunc result for job id P41222

User Input

>input (190 residues)
MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKA
ALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSV
VETDYDQYALLYSQGSKGPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFL
PQTDKCMTEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41222	1.000	1.000	9.079E-36	190	1.000	1.000	P41222.pdb.gz	PTGDS_HUMAN Prostaglandin-H2 D-isomerase OS=Homo sapiens OX=9606 GN=PTGDS PE=1 SV=1
2	PDB:3o2yA	0.835	0.991	8.632E-29	160	0.837	0.994	3o2yA.pdb.gz
3	AFDB:O97921	0.827	0.811	4.092E-26	194	0.742	0.727	O97921.pdb.gz	PTGDS_HORSE Prostaglandin-H2 D-isomerase OS=Equus caballus OX=9796 GN=PTGDS PE=1 SV=1
4	AFDB:P22057	0.832	0.837	5.922E-26	189	0.689	0.693	P22057.pdb.gz	PTGDS_RAT Prostaglandin-H2 D-isomerase OS=Rattus norvegicus OX=10116 GN=Ptgds PE=1 SV=2
5	AFDB:O02853	0.835	0.830	2.337E-25	191	0.721	0.717	O02853.pdb.gz	PTGDS_BOVIN Prostaglandin-H2 D-isomerase OS=Bos taurus OX=9913 GN=PTGDS PE=1 SV=1
6	AFDB:O09114	0.813	0.817	6.506E-24	189	0.689	0.693	O09114.pdb.gz	PTGDS_MOUSE Prostaglandin-H2 D-isomerase OS=Mus musculus OX=10090 GN=Ptgds PE=1 SV=1
7	PDB:2ktdA	0.709	0.795	3.972E-18	167	0.642	0.731	2ktdA.pdb.gz	Solution Structure of Lipocalin-type Prostaglandin D synthase / Substrate analog complex reveals Open-Closed Conformational Change required for Substrate Recognition
8	AFDB:Q64240	0.819	0.468	1.328E-14	349	0.284	0.155	Q64240.pdb.gz	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
9	AFDB:Q07456	0.804	0.450	1.641E-14	349	0.268	0.146	Q07456.pdb.gz	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
10	AFDB:Q6UWW0	0.749	0.772	2.782E-14	184	0.321	0.332	Q6UWW0.pdb.gz	LCN15_HUMAN Lipocalin-15 OS=Homo sapiens OX=9606 GN=LCN15 PE=1 SV=1
11	AFDB:Q8QGV4	0.792	0.817	2.782E-14	184	0.274	0.283	Q8QGV4.pdb.gz
12	AFDB:P30152	0.761	0.732	3.819E-14	198	0.284	0.273	P30152.pdb.gz	NGAL_RAT Neutrophil gelatinase-associated lipocalin OS=Rattus norvegicus OX=10116 GN=Lcn2 PE=1 SV=2
13	PDB:5n48A	0.757	0.818	7.314E-14	175	0.263	0.286	5n48A.pdb.gz
14	PDB:3s26A	0.733	0.817	1.795E-13	169	0.268	0.302	3s26A.pdb.gz
15	PDB:5nknA	0.730	0.800	4.404E-13	172	0.284	0.314	5nknA.pdb.gz	An engineered lipocalin that tightly complexes the plant poison colchicine for use as antidote and in bioanalytical applications.
16	PDB:4qaeB	0.740	0.800	7.467E-13	175	0.268	0.291	4qaeB.pdb.gz	Structure of a hepcidin-binding anticalin in complex with its peptide ligand
17	PDB:6qmuA	0.722	0.745	1.266E-12	184	0.253	0.261	6qmuA.pdb.gz	A Tetrahedral Boronic Acid Diester Formed by an Unnatural Amino Acid in the Ligand Pocket of an Engineered Lipocalin.
18	PDB:4iawA	0.769	0.809	1.564E-12	180	0.279	0.294	4iawA.pdb.gz	Structure-guided engineering of Anticalins with improved binding behavior and biochemical characteristics for application in radio-immuno imaging and/or therapy
19	PDB:4gh7A	0.738	0.800	1.932E-12	174	0.253	0.276	4gh7A.pdb.gz
20	PDB:6z2cA	0.744	0.790	2.386E-12	178	0.242	0.258	6z2cA.pdb.gz	Structure of an engineered lipocalin that catalyzes a Diels-Alder reaction

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41222	8.55e-143	397	190	1.000	1.000	PTGDS_HUMAN Prostaglandin-H2 D-isomerase OS=Homo sapiens OX=9606 GN=PTGDS PE=1 SV=1
2	O97921	2.16e-95	277	194	0.753	0.737	PTGDS_HORSE Prostaglandin-H2 D-isomerase OS=Equus caballus OX=9796 GN=PTGDS PE=1 SV=1
3	O02853	3.06e-95	276	191	0.721	0.717	PTGDS_BOVIN Prostaglandin-H2 D-isomerase OS=Bos taurus OX=9913 GN=PTGDS PE=1 SV=1
4	O09114	1.41e-93	272	189	0.721	0.725	PTGDS_MOUSE Prostaglandin-H2 D-isomerase OS=Mus musculus OX=10090 GN=Ptgds PE=1 SV=1
5	P22057	2.79e-89	261	189	0.689	0.693	PTGDS_RAT Prostaglandin-H2 D-isomerase OS=Rattus norvegicus OX=10116 GN=Ptgds PE=1 SV=2
6	Q9XSM0	2.29e-88	259	191	0.684	0.681	PTGDS_SHEEP Prostaglandin-H2 D-isomerase OS=Ovis aries OX=9940 GN=PTGDS PE=1 SV=1
7	P30152	8.58e-28	105	198	0.332	0.318	NGAL_RAT Neutrophil gelatinase-associated lipocalin OS=Rattus norvegicus OX=10116 GN=Lcn2 PE=1 SV=2
8	P11672	3.69e-26	101	200	0.337	0.320	NGAL_MOUSE Neutrophil gelatinase-associated lipocalin OS=Mus musculus OX=10090 GN=Lcn2 PE=1 SV=1
9	Q8QGV5	4.64e-25	97.8	184	0.300	0.310	Q8QGV5_DANRE Lipocalin-type prostaglandin D synthase-like protein OS=Danio rerio OX=7955 GN=ptgds PE=1 SV=1
10	Q6UWW0	9.02e-22	89.4	184	0.326	0.337	LCN15_HUMAN Lipocalin-15 OS=Homo sapiens OX=9606 GN=LCN15 PE=1 SV=1
11	P80188	2.03e-19	83.6	198	0.305	0.293	NGAL_HUMAN Neutrophil gelatinase-associated lipocalin OS=Homo sapiens OX=9606 GN=LCN2 PE=1 SV=2
12	A0A8I6ABS4	2.71e-18	80.1	181	0.274	0.287	A0A8I6ABS4_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup4 PE=3 SV=1
13	Q64240	2.85e-18	83.2	349	0.253	0.138	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
14	Q07456	7.68e-18	81.6	349	0.247	0.135	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
15	A0A8I6AMI2	3.06e-17	77.4	181	0.268	0.282	A0A8I6AMI2_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=LOC259244 PE=3 SV=1
16	A0A8I5Y2J8	1.12e-16	75.9	181	0.263	0.276	A0A8I5Y2J8_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup4 PE=3 SV=1
17	P02761	1.39e-16	75.9	181	0.263	0.276	MUP_RAT Major urinary protein OS=Rattus norvegicus OX=10116 PE=1 SV=1
18	A0A096MK41	4.05e-16	74.3	181	0.258	0.271	A0A096MK41_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup18 PE=3 SV=1
19	Q78E14	2.22e-15	72.4	179	0.232	0.246	Q78E14_RAT Alpha-2u globulin PGCL4 OS=Rattus norvegicus OX=10116 GN=Obp3 PE=2 SV=1
20	P02760	4.60e-15	73.9	352	0.237	0.128	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	1.4e-31	121.1	Lipocalin / cytosolic fatty-acid binding protein family
2	PF03973 Triabin	4	18.8	Triabin
3	PF07137 VDE	56	14.7	VDE lipocalin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342385	0.962	Prostaglandin E synthase
2	9606.ENSP00000244043	0.955	Prostacyclin synthase
3	9606.ENSP00000345341	0.949	Prostaglandin E synthase 2
4	9606.ENSP00000295256	0.947	Hematopoietic prostaglandin D synthase
5	9606.ENSP00000354612	0.946	Prostaglandin G/H synthase 1
6	9606.ENSP00000356438	0.945	Prostaglandin G/H synthase 2
7	9606.ENSP00000482075	0.945	Prostaglandin E synthase 3
8	9606.ENSP00000369927	0.943	Aldo-keto reductase family 1 member C3
9	9606.ENSP00000245479	0.936	Transcription factor SOX-9
10	9606.ENSP00000381448	0.764	Cystatin-C
11	9606.ENSP00000303424	0.656	Prostaglandin D2 receptor
12	9606.ENSP00000263598	0.651	Lipocalin-1
13	9606.ENSP00000417898	0.643	Glycodelin
14	9606.ENSP00000237014	0.637	Transthyretin
15	9606.ENSP00000345179	0.634	Apolipoprotein D
16	9606.ENSP00000386162	0.630	Lipocalin-like 1 protein
17	9606.ENSP00000478061	0.630	Myristoylated alanine-rich C-kinase substrate
18	9606.ENSP00000345192	0.626	Noelin-3
19	9606.ENSP00000224181	0.625	Complement component C8 gamma chain
20	9606.ENSP00000254722	0.605	Pigment epithelium-derived factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0005515	0.999	protein binding
GO:0043168	0.999	anion binding
GO:0016860	0.999	intramolecular oxidoreductase activity
GO:0036094	0.998	small molecule binding
GO:0033293	0.988	monocarboxylic acid binding
GO:0005504	0.971	fatty acid binding
GO:0019840	0.419	isoprenoid binding
GO:0005501	0.413	retinoid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.995	metabolic process
GO:0006633	0.986	fatty acid biosynthetic process
GO:0033559	0.953	unsaturated fatty acid metabolic process
GO:0006690	0.944	icosanoid metabolic process
GO:0006692	0.900	prostanoid metabolic process
GO:0006693	0.894	prostaglandin metabolic process
GO:0065007	0.881	biological regulation
GO:0046456	0.881	icosanoid biosynthetic process
GO:0050789	0.871	regulation of biological process
GO:0006636	0.845	unsaturated fatty acid biosynthetic process
GO:0001516	0.836	prostaglandin biosynthetic process
GO:0050794	0.820	regulation of cellular process
GO:0001676	0.798	long-chain fatty acid metabolic process
GO:0120254	0.779	olefinic compound metabolic process
GO:0050896	0.639	response to stimulus
GO:0019369	0.579	arachidonic acid metabolic process
GO:0048519	0.468	negative regulation of biological process
GO:0048523	0.411	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.980	membrane-bounded organelle
GO:0005622	0.975	intracellular anatomical structure
GO:0043229	0.964	intracellular organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0005737	0.931	cytoplasm
GO:0012505	0.918	endomembrane system
GO:0005615	0.863	extracellular space
GO:0031982	0.737	vesicle
GO:0016020	0.722	membrane
GO:0065010	0.636	extracellular membrane-bounded organelle
GO:1903561	0.609	extracellular vesicle
GO:0070062	0.557	extracellular exosome
GO:0070013	0.394	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.-.-	0.999	Intramolecular oxidoreductases.

[back to server]