StarFunc result for job id P41226

User Input

>input (1012 residues)
MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLT
LHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQ
VVVLTAAKLEEQLKVGTLCHKHGVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAA
IQHISQGSPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEIGD
TTTFSRYLRGGAITEVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKF
QHLHGRPPQPWDPVDAETVVGLARDLEPLKRTEEEPLEEPLDEALVRTVALSSAGVLSPM
VAMLGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGELLPSPEDCALRGSRYDGQIA
VFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGAGNSGGLTVVDMDHIERSNLSRQ
FLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAALD
SFQARRYVAARCTHYLKPLLEAGTSGTWGSATVFMPHVTEAYRAPASAAASEDAPYPVCT
VRYFPSTAEHTLQWARHEFEELFRLSAETINHHQQAHTSLADMDEPQTLTLLKPVLGVLR
VRPQNWQDCVAWALGHWKLCFHYGIKQLLRHFPPNKVLEDGTPFWSGPKQCPQPLEFDTN
QDTHLLYVLAAANLYAQMHGLPGSQDWTALRELLKLLPQPDPQQMAPIFASNLELASASA
EFGPEQQKELNKALEVWSVGPPLKPLMFEKDDDSNFHVDFVVAAASLRCQNYGIPPVNRA
QSKRIVGQIIPAIATTTAAVAGLLGLELYKVVSGPRPRSAFRHSYLHLAENYLIRYMPFA
PAIQTFHHLKWTSWDRLKVPAGQPERTLESLLAHLQEQHGLRVRILLHGSALLYAAGWSP
EKQAQHLPLRVTELVQQLTGQAPAPGQRVLVLELSCEGDDEDTAFPPLHYEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1A3	0.935	0.895	0.000	1058	0.465	0.445	A0A024R1A3.pdb.gz	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:F1RCA1	0.938	0.898	0.000	1058	0.458	0.438	F1RCA1.pdb.gz
3	AFDB:P31254	0.930	0.891	0.000	1058	0.458	0.439	P31254.pdb.gz	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
4	AFDB:P41226	1.000	1.000	0.000	1012	1.000	1.000	P41226.pdb.gz	UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens OX=9606 GN=UBA7 PE=1 SV=2
5	AFDB:Q55C16	0.914	0.910	0.000	1017	0.384	0.382	Q55C16.pdb.gz	UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum OX=44689 GN=uba1 PE=3 SV=1
6	AFDB:Q8BTN4	0.844	0.942	0.000	905	0.658	0.736	Q8BTN4.pdb.gz	Q8BTN4_MOUSE Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Mus musculus OX=10090 GN=Uba7 PE=2 SV=1
7	AFDB:Q9DBK7	0.934	0.967	0.000	977	0.721	0.747	Q9DBK7.pdb.gz	Q9DBK7_MOUSE E1 ubiquitin-activating enzyme OS=Mus musculus OX=10090 GN=Uba7 PE=1 SV=1
8	AFDB:Q8T0L3	0.921	0.786	4.349E-104	1191	0.407	0.346	Q8T0L3.pdb.gz	Q8T0L3_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
9	PDB:6dc6C	0.904	0.918	4.830E-102	996	0.458	0.465	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
10	AFDB:O94609	0.914	0.914	6.744E-102	1012	0.391	0.391	O94609.pdb.gz	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
11	AFDB:P22515	0.926	0.915	3.700E-101	1024	0.380	0.376	P22515.pdb.gz	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
12	PDB:5l6iA	0.909	0.913	2.359E-97	1007	0.376	0.378	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
13	PDB:4ii3A	0.893	0.915	1.118E-96	986	0.386	0.397	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
14	PDB:7k5jI	0.871	0.899	3.054E-95	979	0.373	0.385	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.
15	PDB:7solA	0.858	0.859	1.131E-88	1011	0.364	0.364	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
16	PDB:7pvnB	0.879	0.898	3.242E-87	990	0.366	0.374	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
17	PDB:3kycB	0.312	0.556	3.962E-21	548	0.135	0.250	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
18	PDB:1y8rA	0.255	0.785	6.541E-19	314	0.095	0.306	1y8rA.pdb.gz	Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1
19	PDB:6xoiB	0.298	0.725	1.907E-18	403	0.120	0.300	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
20	PDB:6cwyD	0.210	0.403	1.271E-17	487	0.125	0.259	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024R1A3	890	1058	0.470	0.450	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A0B4KF46	741	1008	0.411	0.413	A0A0B4KF46_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
3	A0A8I6A544	883	1057	0.466	0.447	A0A8I6A544_RAT E1 ubiquitin-activating enzyme OS=Rattus norvegicus OX=10116 GN=Uba1y PE=3 SV=1
4	A0AVT1	602	1052	0.381	0.367	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1
5	C1P636	636	1112	0.375	0.342	C1P636_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
6	C8VMA9	716	1033	0.402	0.394	C8VMA9_EMENI E1 ubiquitin activating enzyme (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10266 PE=3 SV=1
7	H3BJA7	630	410	0.311	0.768	H3BJA7_MOUSE Ubiquitin-like modifier activating enzyme 7 OS=Mus musculus OX=10090 GN=Uba7 PE=1 SV=1
8	O46111	746	1008	0.413	0.415	O46111_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=2 SV=1
9	O94609	702	1012	0.395	0.395	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
10	P22314	890	1058	0.470	0.450	UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3
11	P22515	679	1024	0.391	0.387	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
12	P31254	874	1058	0.460	0.440	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
13	P41226	2073	1012	1.000	1.000	UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens OX=9606 GN=UBA7 PE=1 SV=2
14	P92974	643	1077	0.385	0.362	UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana OX=3702 GN=UBA2 PE=1 SV=1
15	P93028	616	1080	0.377	0.354	UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
16	Q02053	901	1058	0.471	0.451	UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus OX=10090 GN=Uba1 PE=1 SV=1
17	Q27481	636	1113	0.375	0.341	Q27481_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
18	Q3S1J5	637	1028	0.375	0.370	Q3S1J5_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
19	Q55C16	698	1017	0.397	0.395	UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum OX=44689 GN=uba1 PE=3 SV=1
20	Q6P9P3	894	1058	0.458	0.439	Q6P9P3_DANRE Ubiquitin-like modifier-activating enzyme 1 OS=Danio rerio OX=7955 GN=wu:fb30f01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14827 dCache_3	3.3e+02	12.3	Double sensory domain of two-component sensor kinase
2	PF16191 E1_4HB	2.4e-14	64.5	Ubiquitin-activating enzyme E1 four-helix bundle
3	PF16190 E1_FCCH	1.7e-19	81.0	Ubiquitin-activating enzyme E1 FCCH domain
4	PF09358 E1_UFD	1.4e-19	81.8	Ubiquitin fold domain
5	PF00899 ThiF	5.9e-105	360.8	ThiF family
6	PF10585 UBA_E1_SCCH	3e-68	242.1	Ubiquitin-activating enzyme, SCCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368699	0.999	Ubiquitin-like protein ISG15
2	9606.ENSP00000287156	0.994	Ubiquitin/ISG15-conjugating enzyme E2 L6
3	9606.ENSP00000379931	0.988	Ubiquitin-conjugating enzyme E2 E2
4	9606.ENSP00000215574	0.978	Ubiquitin-conjugating enzyme E2 R1
5	9606.ENSP00000303709	0.977	Ubiquitin-conjugating enzyme E2 E1
6	9606.ENSP00000380178	0.975	Ubiquitin-conjugating enzyme E2 G1
7	9606.ENSP00000261427	0.974	Ubiquitin-conjugating enzyme E2 K
8	9606.ENSP00000263228	0.974	Ubiquitin-conjugating enzyme E2 R2
9	9606.ENSP00000265339	0.973	Ubiquitin-conjugating enzyme E2 B
10	9606.ENSP00000360613	0.973	Ubiquitin-conjugating enzyme E2 A
11	9606.ENSP00000348838	0.969	Ubiquitin-conjugating enzyme E2 C
12	9606.ENSP00000316176	0.967	Ubiquitin-conjugating enzyme E2 N
13	9606.ENSP00000381717	0.967	Ubiquitin-conjugating enzyme E2 D2
14	9606.ENSP00000338348	0.965	Ubiquitin-conjugating enzyme E2 G2
15	9606.ENSP00000253023	0.964	NEDD8-conjugating enzyme Ubc12
16	9606.ENSP00000386788	0.963	Ubiquitin-conjugating enzyme E2 E3
17	9606.ENSP00000363019	0.962	Ubiquitin-conjugating enzyme E2 D1
18	9606.ENSP00000349722	0.961	Ubiquitin conjugating enzyme E2 D3
19	9606.ENSP00000478474	0.960	NEDD8-conjugating enzyme UBE2F
20	9606.ENSP00000360116	0.959	Ubiquitin-conjugating enzyme E2 U

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008641	0.999	ubiquitin-like modifier activating enzyme activity
GO:0005515	0.992	protein binding
GO:0004842	0.869	ubiquitin-protein transferase activity
GO:0004839	0.683	ubiquitin activating enzyme activity
GO:0019782	0.416	ISG15 activating enzyme activity
GO:1901363	0.318	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.996	protein metabolic process
GO:0032446	0.987	protein modification by small protein conjugation
GO:0009987	0.926	cellular process
GO:0044237	0.643	cellular metabolic process
GO:0009056	0.454	catabolic process
GO:0044248	0.396	cellular catabolic process
GO:0044260	0.374	cellular macromolecule metabolic process
GO:0065007	0.315	biological regulation
GO:0050789	0.314	regulation of biological process
GO:0030163	0.310	protein catabolic process
GO:0006508	0.306	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	0.999	Forming carbon-sulfur bonds.
EC:2.-.-.-	0.869	Transferases.
EC:6.2.1.45	0.683	E1 ubiquitin-activating enzyme.

[back to server]