StarFunc result for job id P41227

User Input

>input (235 residues)
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH
LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV
ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41227	1.000	1.000	2.261E-45	235	1.000	1.000	P41227.pdb.gz	NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1
2	AFDB:Q9BSU3	0.736	0.754	3.837E-37	229	0.813	0.834	Q9BSU3.pdb.gz	NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens OX=9606 GN=NAA11 PE=1 SV=3
3	AFDB:Q7T3B8	0.677	0.710	3.729E-36	224	0.774	0.812	Q7T3B8.pdb.gz	Q7T3B8_DANRE N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Danio rerio OX=7955 GN=ard1a PE=1 SV=1
4	AFDB:Q9VT75	0.734	0.874	6.662E-32	196	0.566	0.679	Q9VT75.pdb.gz	Q9VT75_DROME N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Drosophila melanogaster OX=7227 GN=vnc PE=1 SV=1
5	PDB:6c95B	0.668	0.971	1.671E-31	161	0.677	0.988	6c95B.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
6	AFDB:O61219	0.672	0.865	4.887E-30	182	0.528	0.681	O61219.pdb.gz	DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans OX=6239 GN=daf-31 PE=2 SV=1
7	AFDB:Q9UTI3	0.643	0.852	1.690E-26	177	0.438	0.582	Q9UTI3.pdb.gz	ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ard1 PE=1 SV=1
8	AFDB:Q9FKI4	0.629	0.769	8.731E-26	192	0.451	0.552	Q9FKI4.pdb.gz	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
9	AFDB:Q385W4	0.633	0.623	4.235E-25	239	0.430	0.423	Q385W4.pdb.gz	Q385W4_TRYB2 N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2110 PE=3 SV=1
10	AFDB:Q6P4J0	0.488	0.873	9.091E-23	131	0.481	0.863	Q6P4J0.pdb.gz	Q6P4J0_HUMAN N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Homo sapiens OX=9606 GN=ARD1A PE=1 SV=1
11	AFDB:P07347	0.604	0.597	9.684E-23	238	0.391	0.387	P07347.pdb.gz	ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARD1 PE=1 SV=2
12	PDB:4hnxB	0.558	0.613	3.694E-19	213	0.370	0.408	4hnxB.pdb.gz	The Protein Complex NatA Binds Inositol Hexakisphosphate and Exhibits Conformational Flexibility
13	PDB:6hd5u	0.596	0.596	6.522E-19	235	0.383	0.383	6hd5u.pdb.gz
14	PDB:5c88A	0.601	0.886	8.997E-17	158	0.243	0.361	5c88A.pdb.gz	Multiple Conformations of the Loop Region Confers Heat-Resistance on SsArd1, a Thermophilic NatA.
15	PDB:6ygbA	0.588	0.851	4.266E-13	159	0.174	0.258	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
16	PDB:7l1kA	0.593	0.918	9.104E-13	149	0.166	0.262	7l1kA.pdb.gz	Molecular mechanism of N-terminal acetylation by the ternary NatC complex.
17	PDB:7stxA	0.580	0.841	1.033E-12	158	0.217	0.323	7stxA.pdb.gz	Cryo-EM structure of human NatB in complex with CoA-Alpha-Synuclein
18	PDB:5isvA	0.539	0.789	5.525E-11	156	0.149	0.224	5isvA.pdb.gz
19	PDB:2ob0C	0.577	0.802	6.269E-11	166	0.149	0.211	2ob0C.pdb.gz	Structure of Human MAK3 homolog
20	PDB:5hgzA	0.558	0.617	8.900E-10	211	0.153	0.171	5hgzA.pdb.gz	Structure and function of human Naa60 (NatF), a Golgi-localized bi-functional acetyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41227	8.20e-178	489	235	1.000	1.000	NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10 PE=1 SV=1
2	Q9QY36	2.74e-163	452	235	0.919	0.919	NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus OX=10090 GN=Naa10 PE=1 SV=1
3	Q9BSU3	4.53e-131	370	229	0.779	0.799	NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens OX=9606 GN=NAA11 PE=1 SV=3
4	Q7T3B8	7.38e-128	362	224	0.787	0.826	Q7T3B8_DANRE N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Danio rerio OX=7955 GN=ard1a PE=1 SV=1
5	Q9VT75	4.92e-92	270	196	0.540	0.648	Q9VT75_DROME N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Drosophila melanogaster OX=7227 GN=vnc PE=1 SV=1
6	O61219	2.25e-90	266	182	0.528	0.681	DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans OX=6239 GN=daf-31 PE=2 SV=1
7	Q6P4J0	4.53e-83	245	131	0.481	0.863	Q6P4J0_HUMAN N-terminal amino-acid N(alpha)-acetyltransferase NatA OS=Homo sapiens OX=9606 GN=ARD1A PE=1 SV=1
8	Q9UTI3	9.65e-73	221	177	0.426	0.565	ARD1_SCHPO N-terminal acetyltransferase A complex catalytic subunit ard1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ard1 PE=1 SV=1
9	Q9FKI4	2.61e-70	215	192	0.426	0.521	NAA10_ARATH N-terminal acetyltransferase A complex catalytic subunit NAA10 OS=Arabidopsis thaliana OX=3702 GN=NAA10 PE=1 SV=1
10	Q385W4	2.59e-61	194	239	0.387	0.381	Q385W4_TRYB2 N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2110 PE=3 SV=1
11	Q9NFL8	2.64e-61	194	239	0.387	0.381	Q9NFL8_9TRYP Putative N-acetyltransferase subunit ARD1 OS=Trypanosoma brucei OX=5691 GN=ARD1 PE=3 SV=1
12	P07347	1.24e-51	169	238	0.391	0.387	ARD1_YEAST N-terminal acetyltransferase A complex catalytic subunit ARD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARD1 PE=1 SV=2
13	Q980R9	8.85e-26	100	167	0.251	0.353	NAT_SACS2 N-alpha-acetyltransferase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=ard1 PE=1 SV=2
14	M9PI14	1.29e-21	90.1	180	0.234	0.306	M9PI14_DROME N(Alpha)-acetyltransferase 20 A, isoform B OS=Drosophila melanogaster OX=7227 GN=Naa20A PE=4 SV=1
15	A8MZB2	4.43e-19	83.2	166	0.217	0.307	A8MZB2_HUMAN N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae), isoform CRA_a OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1
16	P61599	1.36e-18	82.0	178	0.217	0.287	NAA20_HUMAN N-alpha-acetyltransferase 20 OS=Homo sapiens OX=9606 GN=NAA20 PE=1 SV=1
17	O74457	4.24e-14	70.1	180	0.191	0.250	NAT3_SCHPO N-terminal acetyltransferase B complex catalytic subunit naa20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naa20 PE=3 SV=1
18	O16486	3.76e-13	69.3	278	0.200	0.169	O16486_CAEEL N-acetyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=natc-2 PE=1 SV=1
19	Q06504	9.36e-13	67.0	195	0.200	0.241	NAT3_YEAST N-terminal acetyltransferase B complex catalytic subunit NAT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAT3 PE=1 SV=2
20	O80438	5.26e-12	64.7	190	0.191	0.237	MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana OX=3702 GN=MAK3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	4.4e-12	57.7	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	6.4e-06	37.6	Acetyltransferase (GNAT) domain
3	PF13880 Acetyltransf_13	13	17.1	ESCO1/2 acetyl-transferase
4	PF17013 Acetyltransf_15	18	16.3	Putative acetyl-transferase
5	PF13302 Acetyltransf_3	19	17.4	Acetyltransferase (GNAT) domain
6	PF13508 Acetyltransf_7	0.00011	33.8	Acetyltransferase (GNAT) domain
7	PF13527 Acetyltransf_9	1.7	20.2	Acetyltransferase (GNAT) domain
8	PF08445 FR47	0.00031	32.0	FR47-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010360033.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351783.1	0.998	N(alpha)-acetyltransferase 15, NatA auxiliary subunit
2	61622.XP_010359320.1	0.990	N(alpha)-acetyltransferase 50, NatE catalytic subunit
3	61622.XP_010372807.1	0.988	N(alpha)-acetyltransferase 16, NatA auxiliary subunit
4	61622.XP_010376371.1	0.967	N(alpha)-acetyltransferase 35, NatC auxiliary subunit
5	61622.XP_010374348.1	0.960	N(alpha)-acetyltransferase 60, NatF catalytic subunit
6	61622.XP_010377106.1	0.946	N(alpha)-acetyltransferase 25, NatB auxiliary subunit
7	61622.XP_010379789.1	0.935	Lysine acetyltransferase 14
8	61622.XP_010383547.1	0.934	Huntingtin-interacting protein K isoform X1
9	61622.XP_010354303.1	0.909	N(alpha)-acetyltransferase 30, NatC catalytic subunit
10	61622.XP_010352951.1	0.901	Hypoxia inducible factor 1 alpha subunit
11	61622.XP_010358140.1	0.887	N(alpha)-acetyltransferase 11, NatA catalytic subunit
12	61622.XP_010382207.1	0.836	Cotranslationally removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met- Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Rule:MF_03175, ECO:0000256\|RuleBase:RU003653,
13	61622.XP_010367421.1	0.828	N(alpha)-acetyltransferase 20, NatB catalytic subunit
14	61622.XP_010360701.1	0.785	N(alpha)-acetyltransferase 38, NatC auxiliary subunit
15	61622.XP_010360273.1	0.771	N-acetyltransferase 8-like isoform X1
16	61622.XP_010382662.1	0.771	N-acetyltransferase 8 like
17	61622.XP_010378399.1	0.740	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
18	61622.XP_010383516.1	0.738	VHL binding protein 1
19	61622.XP_010364772.1	0.708	RELA proto-oncogene, NF-kB subunit
20	61622.XP_010362082.1	0.679	Proteasome activator subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004596	1.000	peptide alpha-N-acetyltransferase activity
GO:0043021	0.481	ribonucleoprotein complex binding
GO:0043022	0.469	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010467	0.996	gene expression
GO:0006473	0.995	protein acetylation
GO:0031365	0.984	N-terminal protein amino acid modification
GO:0051604	0.972	protein maturation
GO:0050789	0.956	regulation of biological process
GO:0050794	0.930	regulation of cellular process
GO:0009987	0.918	cellular process
GO:0051128	0.616	regulation of cellular component organization
GO:0048519	0.597	negative regulation of biological process
GO:0033044	0.507	regulation of chromosome organization
GO:0048523	0.465	negative regulation of cellular process
GO:0071840	0.389	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0140535	0.998	intracellular protein-containing complex
GO:0031981	0.998	nuclear lumen
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:1902494	0.996	catalytic complex
GO:1990234	0.987	transferase complex
GO:0016020	0.981	membrane
GO:0031414	0.976	N-terminal protein acetyltransferase complex
GO:0005654	0.906	nucleoplasm
GO:0031415	0.480	NatA complex
GO:0012505	0.459	endomembrane system
GO:0005730	0.393	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]