StarFunc result for job id P41229

User Input

>input (1560 residues)
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGP
HRVAGLQMTLTELRAFLDQMNNLPCAMHQIGDVKGVLEQVEAYQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASSSTASSTTSICVCGQVLAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQRLQAEPR
PEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSVTSPEKVAPEEGSGKRDLELLSSL
LPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLEL
EKAERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE
ETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0S6L0	0.466	0.461	0.000	1578	0.626	0.619	B0S6L0.pdb.gz	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
2	AFDB:P41229	1.000	1.000	0.000	1560	1.000	1.000	P41229.pdb.gz	KDM5C_HUMAN Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2
3	AFDB:Q62240	0.700	0.705	0.000	1548	0.785	0.791	Q62240.pdb.gz	KDM5D_MOUSE Lysine-specific demethylase 5D OS=Mus musculus OX=10090 GN=Kdm5d PE=2 SV=2
4	AFDB:Q9BY66	0.685	0.694	0.000	1539	0.847	0.859	Q9BY66.pdb.gz	KDM5D_HUMAN Lysine-specific demethylase 5D OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=2
5	AFDB:Q9VMJ7	0.476	0.408	0.000	1838	0.413	0.350	Q9VMJ7.pdb.gz	KDM5_DROME Lysine-specific demethylase 5 OS=Drosophila melanogaster OX=7227 GN=Kdm5 PE=1 SV=1
6	AFDB:Q23541	0.397	0.418	1.910E-78	1477	0.258	0.272	Q23541.pdb.gz	KDM5_CAEEL Lysine-specific demethylase rbr-2 OS=Caenorhabditis elegans OX=6239 GN=rbr-2 PE=1 SV=2
7	AFDB:Q9HDV4	0.329	0.338	1.681E-53	1513	0.183	0.188	Q9HDV4.pdb.gz	LID2_SCHPO Lid2 complex component lid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lid2 PE=1 SV=1
8	AFDB:F4I240	0.237	0.304	1.518E-45	1208	0.199	0.257	F4I240.pdb.gz	JMJ17_ARATH Lysine-specific demethylase JMJ17 OS=Arabidopsis thaliana OX=3702 GN=JMJ17 PE=1 SV=1
9	AFDB:Q9UT79	0.363	0.358	4.475E-44	1588	0.164	0.161	Q9UT79.pdb.gz	MSC1_SCHPO Multicopy suppressor of chk1 protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msc1 PE=3 SV=1
10	AFDB:Q9US53	0.326	0.681	4.469E-43	715	0.139	0.303	Q9US53.pdb.gz	JMJ2_SCHPO Jumonji/ARID domain-containing protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=jmj2 PE=4 SV=1
11	PDB:3al5B	0.056	0.253	6.604E-3	311	0.008	0.039	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:4b7eA	0.088	0.318	1.242E-2	349	0.013	0.060	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
13	PDB:7cl4F	0.051	0.233	1.703E-2	285	0.014	0.077	7cl4F.pdb.gz
14	PDB:4qszA	0.064	0.138	2.444E-2	686	0.010	0.022	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
15	PDB:5zmdG	0.069	0.209	2.444E-2	403	0.023	0.089	5zmdG.pdb.gz	Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
16	PDB:3al5C	0.063	0.295	2.557E-2	284	0.009	0.049	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
17	PDB:7yxgA	0.074	0.300	2.557E-2	313	0.012	0.058	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
18	PDB:5ybnA	0.065	0.258	3.204E-2	296	0.015	0.081	5ybnA.pdb.gz	Structure function and engineering of multifunctional non-heme iron dependent oxygenases in fungal meroterpenoid biosynthesis.
19	PDB:5nfnB	0.059	0.250	3.837E-2	318	0.015	0.075	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
20	PDB:4cclB	0.062	0.231	4.394E-2	372	0.012	0.048	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096MJZ8	1514	1635	0.483	0.461	A0A096MJZ8_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
2	A0A0G2JTU9	1508	1553	0.483	0.485	A0A0G2JTU9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=2
3	A0A0G2JW30	1197	630	0.362	0.897	A0A0G2JW30_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=3 SV=2
4	A0A0G2K1H0	2941	1554	0.949	0.953	A0A0G2K1H0_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=1
5	A0A0G2K3N6	1350	1544	0.467	0.472	A0A0G2K3N6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
6	A0A0G2K454	1514	1634	0.483	0.461	A0A0G2K454_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=1 SV=1
7	A0A0G2K6G9	1353	1517	0.468	0.481	A0A0G2K6G9_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5b PE=3 SV=2
8	A0A0G2K897	2801	1510	0.917	0.947	A0A0G2K897_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5c PE=1 SV=2
9	A0A384MR42	2627	1539	0.839	0.851	A0A384MR42_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=SMCY PE=2 SV=1
10	A0A3B3IS40	1347	1539	0.464	0.470	A0A3B3IS40_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
11	A0A3B3ISE6	1274	1472	0.446	0.472	A0A3B3ISE6_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
12	A0A3B3IT25	1363	1517	0.466	0.479	A0A3B3IT25_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
13	A0A3B3ITA8	1312	1499	0.453	0.471	A0A3B3ITA8_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
14	A0A3B3ITE7	1362	1505	0.466	0.483	A0A3B3ITE7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
15	A0A3B3ITJ7	1272	1503	0.446	0.462	A0A3B3ITJ7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
16	A0A8I5ZPK6	1513	1636	0.483	0.460	A0A8I5ZPK6_RAT [histone H3]-trimethyl-L-lysine(4) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm5a PE=3 SV=1
17	A6N6J7	2954	1440	0.922	0.999	A6N6J7_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase OS=Homo sapiens OX=9606 GN=JARID1C PE=2 SV=1
18	B0S6L0	1921	1578	0.630	0.623	B0S6L0_DANRE [histone H3]-trimethyl-L-lysine(4) demethylase OS=Danio rerio OX=7955 GN=im:7158173 PE=1 SV=1
19	B3KV94	1139	1275	0.403	0.493	B3KV94_HUMAN Jumonji, AT rich interactive domain 1B (RBP2-like), isoform CRA_a (Fragment) OS=Homo sapiens OX=9606 GN=KDM5B PE=1 SV=1
20	E9PFH2	2518	1476	0.808	0.854	E9PFH2_HUMAN [histone H3]-trimethyl-L-lysine(4) demethylase (Fragment) OS=Homo sapiens OX=9606 GN=KDM5D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01388 ARID	1.1e-12	59.8	ARID/BRIGHT DNA binding domain
2	PF02373 JmjC	2.4e-40	148.9	JmjC domain, hydroxylase
3	PF02375 JmjN	1e-12	58.9	jmjN domain
4	PF00628 PHD	4e-12	57.1	PHD-finger
5	PF08429 PLU-1	5.2e-90	313.6	PLU-1-like protein
6	PF02928 zf-C5HC2	5.6e-12	57.1	C5HC2 zinc finger
7	PF16744 zf-RING_15	43	15.6	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362649	0.977	Histone deacetylase 1
2	9606.ENSP00000420095	0.970	Protein kinase C-binding protein 1
3	9606.ENSP00000262241	0.936	REST corepressor 1
4	9606.ENSP00000364678	0.933	Histone-lysine N-methyltransferase EHMT2
5	9606.ENSP00000386759	0.887	Histone-lysine N-methyltransferase SETD2
6	9606.ENSP00000367203	0.880	Lysine-specific demethylase 6A
7	9606.ENSP00000288014	0.851	Thiamine-triphosphatase
8	9606.ENSP00000378307	0.843	Protein polybromo-1
9	9606.ENSP00000350676	0.827	Histone lysine demethylase PHF8
10	9606.ENSP00000311816	0.820	RE1-silencing transcription factor
11	9606.ENSP00000452877	0.810	Zinc finger protein 592
12	9606.ENSP00000364591	0.797	Testis-specific Y-encoded-like protein 2
13	9606.ENSP00000383042	0.796	Lysine-specific histone demethylase 1A
14	9606.ENSP00000338217	0.778	Zinc finger protein 532
15	9606.ENSP00000333277	0.773	Histone cluster 2 H3 family member d
16	9606.ENSP00000337976	0.772	Histone-lysine N-methyltransferase SUV39H1
17	9606.ENSP00000445508	0.772	CCR4-NOT transcription complex subunit 4
18	9606.ENSP00000316357	0.769	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
19	9606.ENSP00000363787	0.765	E3 ubiquitin-protein ligase RING1
20	9606.ENSP00000368927	0.752	Eukaryotic translation initiation factor 1A, X-chromosomal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0032453	0.994	histone H3K4 demethylase activity
GO:0008270	0.864	zinc ion binding
GO:0003676	0.578	nucleic acid binding
GO:0003677	0.527	DNA binding
GO:0043565	0.364	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.976	regulation of cellular process
GO:0050896	0.911	response to stimulus
GO:0019222	0.879	regulation of metabolic process
GO:0060255	0.854	regulation of macromolecule metabolic process
GO:0051171	0.843	regulation of nitrogen compound metabolic process
GO:0080090	0.842	regulation of primary metabolic process
GO:0031323	0.842	regulation of cellular metabolic process
GO:0048519	0.836	negative regulation of biological process
GO:0010468	0.806	regulation of gene expression
GO:0045892	0.800	negative regulation of DNA-templated transcription
GO:0009636	0.671	response to toxic substance
GO:0009987	0.570	cellular process
GO:0006357	0.403	regulation of transcription by RNA polymerase II
GO:0008152	0.384	metabolic process
GO:0071704	0.371	organic substance metabolic process
GO:0044238	0.324	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0005829	0.984	cytosol
GO:0043232	0.601	intracellular non-membrane-bounded organelle
GO:0032991	0.435	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]