StarFunc result for job id P41231

User Input

>input (377 residues)
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS
ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR
VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK
RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC
LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR
RTESTPAGSENTKDIRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41231	1.000	1.000	1.231E-51	377	1.000	1.000	P41231.pdb.gz	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
2	AFDB:P41232	0.849	0.855	3.570E-44	374	0.881	0.888	P41232.pdb.gz	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
3	AFDB:O35811	0.777	0.811	1.208E-28	361	0.485	0.507	O35811.pdb.gz	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
4	AFDB:P51582	0.774	0.799	1.638E-28	365	0.501	0.518	P51582.pdb.gz	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
5	AFDB:Q63371	0.755	0.864	9.469E-23	328	0.363	0.418	Q63371.pdb.gz	P2RY6_RAT P2Y purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2ry6 PE=2 SV=1
6	AFDB:P47900	0.755	0.762	7.641E-22	373	0.310	0.314	P47900.pdb.gz	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
7	AFDB:Q15077	0.743	0.849	1.405E-21	328	0.342	0.393	Q15077.pdb.gz	P2RY6_HUMAN P2Y purinoceptor 6 OS=Homo sapiens OX=9606 GN=P2RY6 PE=1 SV=1
8	AFDB:Q99JA4	0.732	0.782	1.480E-18	352	0.241	0.259	Q99JA4.pdb.gz	CLTR1_MOUSE Cysteinyl leukotriene receptor 1 OS=Mus musculus OX=10090 GN=Cysltr1 PE=1 SV=1
9	AFDB:Q08BG4	0.718	0.756	2.495E-18	357	0.281	0.297	Q08BG4.pdb.gz	Q08BG4_DANRE Lysophosphatidic acid receptor 6 OS=Danio rerio OX=7955 GN=zgc:153784 PE=1 SV=1
10	AFDB:Q9NS75	0.739	0.802	4.392E-18	346	0.260	0.283	Q9NS75.pdb.gz	CLTR2_HUMAN Cysteinyl leukotriene receptor 2 OS=Homo sapiens OX=9606 GN=CYSLTR2 PE=1 SV=1
11	PDB:5xszA	0.636	0.540	2.809E-13	448	0.279	0.234	5xszA.pdb.gz
12	PDB:7wvuR	0.666	0.831	3.342E-13	298	0.218	0.275	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
13	PDB:6ibbA	0.644	0.798	3.808E-13	301	0.236	0.296	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
14	PDB:8ef5M	0.673	0.862	4.339E-13	288	0.228	0.299	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
15	PDB:7vl9R	0.669	0.823	9.494E-13	302	0.204	0.255	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
16	PDB:7wicR	0.643	0.823	1.287E-12	288	0.220	0.288	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
17	PDB:6lw5A	0.668	0.595	2.942E-12	427	0.215	0.190	6lw5A.pdb.gz	Structural basis of ligand binding modes at the human formyl peptide receptor 2.
18	PDB:6lfmR	0.679	0.824	3.209E-12	307	0.220	0.270	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
19	PDB:7f1tA	0.656	0.588	3.989E-12	423	0.162	0.144	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
20	PDB:5zbqA	0.628	0.519	4.352E-12	463	0.194	0.158	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35383	0.0	641	373	0.897	0.906	P2RY2_MOUSE P2Y purinoceptor 2 OS=Mus musculus OX=10090 GN=P2ry2 PE=1 SV=1
2	P41231	0.0	761	377	1.000	1.000	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
3	P41232	0.0	643	374	0.881	0.888	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
4	O35811	2.46e-124	364	361	0.483	0.504	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
5	P51582	1.75e-122	360	365	0.485	0.501	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
6	Q9JJS7	1.99e-120	354	361	0.469	0.490	P2RY4_MOUSE P2Y purinoceptor 4 OS=Mus musculus OX=10090 GN=P2ry4 PE=2 SV=1
7	Q9ERK9	3.37e-66	214	328	0.366	0.421	P2RY6_MOUSE P2Y purinoceptor 6 OS=Mus musculus OX=10090 GN=P2ry6 PE=2 SV=1
8	P47900	5.94e-65	213	373	0.347	0.351	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
9	P49651	6.34e-65	213	373	0.334	0.338	P2RY1_RAT P2Y purinoceptor 1 OS=Rattus norvegicus OX=10116 GN=P2ry1 PE=2 SV=1
10	P59902	1.11e-64	212	373	0.321	0.324	P2RY1_CAVPO P2Y purinoceptor 1 OS=Cavia porcellus OX=10141 GN=P2RY1 PE=2 SV=1
11	Q63371	8.65e-64	208	328	0.371	0.427	P2RY6_RAT P2Y purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2ry6 PE=2 SV=1
12	P49650	9.79e-64	209	373	0.329	0.332	P2RY1_MOUSE P2Y purinoceptor 1 OS=Mus musculus OX=10090 GN=P2ry1 PE=2 SV=1
13	Q15077	5.08e-61	201	328	0.347	0.399	P2RY6_HUMAN P2Y purinoceptor 6 OS=Homo sapiens OX=9606 GN=P2RY6 PE=1 SV=1
14	Q08BG4	1.03e-53	183	357	0.289	0.305	Q08BG4_DANRE Lysophosphatidic acid receptor 6 OS=Danio rerio OX=7955 GN=zgc:153784 PE=1 SV=1
15	Q8BMC0	1.53e-53	182	344	0.284	0.311	LPAR6_MOUSE Lysophosphatidic acid receptor 6 OS=Mus musculus OX=10090 GN=Lpar6 PE=1 SV=1
16	B2R986	3.66e-51	176	337	0.252	0.282	B2R986_HUMAN HCG1774561 OS=Homo sapiens OX=9606 GN=hCG_1774561 PE=2 SV=1
17	Q96P68	3.66e-51	176	337	0.252	0.282	OXGR1_HUMAN 2-oxoglutarate receptor 1 OS=Homo sapiens OX=9606 GN=OXGR1 PE=2 SV=1
18	X1WDA3	1.24e-50	174	343	0.265	0.292	X1WDA3_DANRE Lysophosphatidic acid receptor 6 OS=Danio rerio OX=7955 GN=lpar6b PE=3 SV=2
19	P43657	1.28e-50	174	344	0.257	0.282	LPAR6_HUMAN Lysophosphatidic acid receptor 6 OS=Homo sapiens OX=9606 GN=LPAR6 PE=1 SV=3
20	A5PLE7	1.47e-47	167	368	0.276	0.283	GP83A_DANRE G-protein coupled receptor 183-A OS=Danio rerio OX=7955 GN=gpr183a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	8.2e-38	141.8	7 transmembrane receptor (rhodopsin family)
2	PF10328 7TM_GPCR_Srx	8.7	17.4	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000409581	0.987	Beta-arrestin-1
2	9606.ENSP00000286548	0.986	Guanine nucleotide-binding protein G(q) subunit alpha
3	9606.ENSP00000358866	0.985	Filamin-A
4	9606.ENSP00000292513	0.928	Prostaglandin E2 receptor EP1 subtype
5	9606.ENSP00000305372	0.924	Beta-2 adrenergic receptor
6	9606.ENSP00000368683	0.922	Endothelin-1
7	9606.ENSP00000312262	0.915	Beta-adrenergic receptor kinase 1
8	9606.ENSP00000379140	0.913	Stromal cell-derived factor 1
9	9606.ENSP00000306490	0.911	Muscarinic acetylcholine receptor M1
10	9606.ENSP00000471493	0.911	fMet-Leu-Phe receptor
11	9606.ENSP00000306662	0.909	Alpha-1B adrenergic receptor
12	9606.ENSP00000248572	0.906	Guanine nucleotide-binding protein G(T) subunit gamma-T1
13	9606.ENSP00000292303	0.906	C-C chemokine receptor type 5
14	9606.ENSP00000308541	0.906	Prothrombin
15	9606.ENSP00000355627	0.906	Angiotensinogen
16	9606.ENSP00000386884	0.906	C-X-C chemokine receptor type 4
17	9606.ENSP00000482259	0.906	C-C motif chemokine 4
18	9606.ENSP00000276198	0.905	5-hydroxytryptamine receptor 2C
19	9606.ENSP00000441600	0.905	C-C chemokine receptor type 3
20	9606.ENSP00000302234	0.904	Eotaxin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	0.999	G protein-coupled receptor activity
GO:0005515	0.995	protein binding
GO:0008528	0.832	G protein-coupled peptide receptor activity
GO:0005102	0.353	signaling receptor binding
GO:0016502	0.300	nucleotide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.993	cellular process
GO:0050896	0.991	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0007154	0.984	cell communication
GO:0023052	0.977	signaling
GO:0007165	0.973	signal transduction
GO:0007186	0.851	G protein-coupled receptor signaling pathway
GO:0071310	0.816	cellular response to organic substance
GO:0009719	0.810	response to endogenous stimulus
GO:0048518	0.765	positive regulation of biological process
GO:0032501	0.688	multicellular organismal process
GO:0007200	0.655	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0048522	0.574	positive regulation of cellular process
GO:0071495	0.552	cellular response to endogenous stimulus
GO:0051234	0.465	establishment of localization
GO:1901700	0.462	response to oxygen-containing compound
GO:0065008	0.460	regulation of biological quality
GO:0006810	0.458	transport
GO:0032879	0.446	regulation of localization
GO:0023051	0.423	regulation of signaling
GO:0010646	0.423	regulation of cell communication
GO:0051239	0.419	regulation of multicellular organismal process
GO:0048583	0.395	regulation of response to stimulus
GO:0019222	0.366	regulation of metabolic process
GO:0048519	0.330	negative regulation of biological process
GO:0051049	0.320	regulation of transport
GO:0009966	0.317	regulation of signal transduction
GO:0048584	0.316	positive regulation of response to stimulus
GO:1901701	0.305	cellular response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.785	intracellular anatomical structure
GO:0043226	0.774	organelle
GO:0043229	0.755	intracellular organelle
GO:0043231	0.735	intracellular membrane-bounded organelle
GO:0005737	0.531	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]