StarFunc result for job id P41235

User Input

>input (474 residues)
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1D8T1	0.706	0.706	7.538E-63	474	1.000	1.000	F1D8T1.pdb.gz	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
2	AFDB:F1NZ15	0.695	0.707	1.936E-54	466	0.859	0.873	F1NZ15.pdb.gz	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
3	AFDB:Q6PHH5	0.755	0.772	1.526E-53	463	0.806	0.825	Q6PHH5.pdb.gz
4	AFDB:A0A6E1WB48	0.685	0.713	2.519E-47	455	0.696	0.725	A0A6E1WB48.pdb.gz	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
5	AFDB:P49866	0.661	0.450	4.831E-37	704	0.519	0.349	P49866.pdb.gz	HNF4_DROME Transcription factor HNF-4 homolog OS=Drosophila melanogaster OX=7227 GN=Hnf4 PE=1 SV=3
6	AFDB:P91829	0.562	0.693	9.266E-27	373	0.285	0.362	P91829.pdb.gz	NHR69_CAEEL Nuclear hormone receptor family member nhr-69 OS=Caenorhabditis elegans OX=6239 GN=nhr-69 PE=1 SV=2
7	AFDB:P51129	0.440	0.444	3.990E-25	470	0.302	0.304	P51129.pdb.gz	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
8	AFDB:Q90417	0.444	0.496	9.113E-25	422	0.306	0.344	Q90417.pdb.gz	RXRBB_DANRE Retinoic acid receptor RXR-beta-B OS=Danio rerio OX=7955 GN=rxrbb PE=2 SV=1
9	AFDB:Q90416	0.433	0.464	1.655E-24	441	0.327	0.351	Q90416.pdb.gz	RXRGA_DANRE Retinoic acid receptor RXR-gamma-A OS=Danio rerio OX=7955 GN=rxrga PE=2 SV=2
10	AFDB:A0A1D5P2B5	0.451	0.458	2.618E-24	467	0.323	0.328	A0A1D5P2B5.pdb.gz	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
11	PDB:3dzyA	0.420	0.650	2.376E-22	302	0.289	0.454	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.386	0.723	2.584E-10	246	0.141	0.272	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.405	0.759	1.412E-9	238	0.110	0.218	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.364	0.637	3.956E-6	259	0.095	0.174	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7jvrR	0.104	0.143	4.160E-1	269	0.059	0.104	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:5wk5A	0.087	0.122	8.280E-1	269	0.059	0.104	5wk5A.pdb.gz
17	PDB:7ocaI	0.090	0.193	9.076E-1	185	0.044	0.114	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
18	PDB:2rsvA	0.090	0.101	1.251	403	0.084	0.099	2rsvA.pdb.gz
19	PDB:7kzqE	0.100	0.109	1.372	419	0.059	0.067	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
20	PDB:5ivw2	0.127	0.186	1.503	274	0.076	0.131	5ivw2.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WXV4	0.0	760	377	0.774	0.973	A0A087WXV4_HUMAN Hepatocyte nuclear factor 4 alpha (Fragment) OS=Homo sapiens OX=9606 GN=HNF4A PE=1 SV=2
2	A0A6E1WB48	0.0	638	455	0.686	0.714	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
3	A8E5K2	0.0	731	427	0.745	0.827	A8E5K2_DANRE Hepatocyte nuclear factor 4-alpha isoform X5 OS=Danio rerio OX=7955 GN=wu:fb58h09 PE=2 SV=1
4	F1D8Q4	0.0	629	445	0.677	0.721	F1D8Q4_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=NR2A2 PE=2 SV=1
5	F1D8S2	0.0	954	464	0.977	0.998	F1D8S2_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 1 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
6	F1D8T0	0.0	911	452	0.920	0.965	F1D8T0_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 4 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
7	F1D8T1	0.0	988	474	1.000	1.000	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
8	F1NZ15	0.0	812	466	0.859	0.873	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
9	P22449	0.0	884	474	0.962	0.962	HNF4A_RAT Hepatocyte nuclear factor 4-alpha OS=Rattus norvegicus OX=10116 GN=Hnf4a PE=1 SV=3
10	P41235	0.0	988	474	1.000	1.000	HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha OS=Homo sapiens OX=9606 GN=HNF4A PE=1 SV=3
11	P49698	0.0	884	474	0.958	0.958	HNF4A_MOUSE Hepatocyte nuclear factor 4-alpha OS=Mus musculus OX=10090 GN=Hnf4a PE=1 SV=2
12	Q14541	0.0	588	408	0.629	0.730	HNF4G_HUMAN Hepatocyte nuclear factor 4-gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=3
13	Q5ILH0	0.0	791	454	0.842	0.879	Q5ILH0_CHICK Hepatic nuclear factor 4alpha OS=Gallus gallus OX=9031 GN=HNF4alpha PE=2 SV=1
14	Q8AXB6	0.0	778	454	0.791	0.826	Q8AXB6_DANRE Hepatocyte nuclear factor 4-alpha OS=Danio rerio OX=7955 GN=id:ibd1279 PE=2 SV=1
15	Q9WUU6	0.0	594	408	0.641	0.745	HNF4G_MOUSE Hepatocyte nuclear factor 4-gamma OS=Mus musculus OX=10090 GN=Hnf4g PE=2 SV=2
16	P49866	6.87e-159	468	704	0.477	0.321	HNF4_DROME Transcription factor HNF-4 homolog OS=Drosophila melanogaster OX=7227 GN=Hnf4 PE=1 SV=3
17	A0A1D5P2B5	1.95e-87	277	467	0.302	0.306	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
18	Q05343	1.13e-86	275	467	0.297	0.302	RXRA_RAT Retinoic acid receptor RXR-alpha OS=Rattus norvegicus OX=10116 GN=Rxra PE=1 SV=1
19	P28700	1.23e-86	275	467	0.297	0.302	RXRA_MOUSE Retinoic acid receptor RXR-alpha OS=Mus musculus OX=10090 GN=Rxra PE=1 SV=1
20	P51128	1.45e-86	275	488	0.302	0.293	RXRA_XENLA Retinoic acid receptor RXR-alpha OS=Xenopus laevis OX=8355 GN=rxra PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	6.9e-35	132.1	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	2.3e-26	103.4	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312987

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264867	0.998	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
2	9606.ENSP00000341551	0.996	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000344456	0.996	Catenin beta-1
4	9606.ENSP00000332973	0.990	Mothers against decapentaplegic homolog 3
5	9606.ENSP00000257555	0.989	Hepatocyte nuclear factor 1-alpha
6	9606.ENSP00000265165	0.987	Lymphoid enhancer-binding factor 1
7	9606.ENSP00000368880	0.973	Forkhead box protein O1
8	9606.ENSP00000263253	0.969	Histone acetyltransferase p300
9	9606.ENSP00000437955	0.954	Hypoxia-inducible factor 1-alpha
10	9606.ENSP00000385216	0.949	Nuclear receptor coactivator 1
11	9606.ENSP00000355925	0.944	Prospero homeobox protein 1
12	9606.ENSP00000254227	0.937	Nuclear receptor subfamily 0 group B member 2
13	9606.ENSP00000262160	0.933	Mothers against decapentaplegic homolog 2
14	9606.ENSP00000269305	0.917	Cellular tumor antigen p53
15	9606.ENSP00000399968	0.903	Nuclear receptor coactivator 2
16	9606.ENSP00000262367	0.901	CREB-binding protein
17	9606.ENSP00000262320	0.898	Axin-1
18	9606.ENSP00000304502	0.895	Homeobox protein SIX2
19	9606.ENSP00000360266	0.892	Transcription factor AP-1
20	9606.ENSP00000348069	0.884	Sterol regulatory element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	0.995	DNA binding
GO:0005515	0.993	protein binding
GO:0043565	0.976	sequence-specific DNA binding
GO:0003690	0.973	double-stranded DNA binding
GO:1990837	0.957	sequence-specific double-stranded DNA binding
GO:0000976	0.945	transcription cis-regulatory region binding
GO:0000981	0.883	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.428	transcription factor binding
GO:0000987	0.336	cis-regulatory region sequence-specific DNA binding
GO:0038023	0.317	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0050896	0.970	response to stimulus
GO:0080090	0.970	regulation of primary metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0009987	0.969	cellular process
GO:0051171	0.952	regulation of nitrogen compound metabolic process
GO:0010468	0.932	regulation of gene expression
GO:0006355	0.898	regulation of DNA-templated transcription
GO:0048522	0.868	positive regulation of cellular process
GO:0031325	0.600	positive regulation of cellular metabolic process
GO:0051173	0.593	positive regulation of nitrogen compound metabolic process
GO:0008152	0.511	metabolic process
GO:0032501	0.439	multicellular organismal process
GO:0009891	0.436	positive regulation of biosynthetic process
GO:0051716	0.435	cellular response to stimulus
GO:0045935	0.420	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.418	positive regulation of cellular biosynthetic process
GO:0006357	0.399	regulation of transcription by RNA polymerase II
GO:0045893	0.395	positive regulation of DNA-templated transcription
GO:0032502	0.389	developmental process
GO:0048519	0.379	negative regulation of biological process
GO:0071704	0.363	organic substance metabolic process
GO:0044238	0.355	primary metabolic process
GO:0042221	0.354	response to chemical
GO:0048523	0.352	negative regulation of cellular process
GO:0048856	0.329	anatomical structure development
GO:0045944	0.323	positive regulation of transcription by RNA polymerase II
GO:0044237	0.321	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.948	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]