StarFunc result for job id P41236

User Input

>input (205 residues)
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPAD
KDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE
SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADG
ESMNTEESNQGSTPSDQQQNKLRSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11845	0.553	0.553	8.149E-26	205	0.917	0.917	P11845.pdb.gz	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
2	AFDB:Q9DCL8	0.214	0.213	1.024E-20	206	0.844	0.840	Q9DCL8.pdb.gz	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
3	AFDB:O14990	0.392	0.397	3.723E-8	202	0.405	0.411	O14990.pdb.gz	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
4	AFDB:Q9N537	0.416	0.440	1.403E-7	193	0.288	0.306	Q9N537.pdb.gz	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
5	PDB:2o8aI	0.251	0.848	5.746E-3	59	0.254	0.881	2o8aI.pdb.gz
6	AFDB:Q86IZ4	0.242	0.197	7.586E-2	261	0.249	0.195	Q86IZ4.pdb.gz	IPP2_DICDI Protein phosphatase inhibitor 2 OS=Dictyostelium discoideum OX=44689 GN=dpiA PE=1 SV=1
7	AFDB:Q9NHP8	0.153	0.076	2.052E-1	513	0.166	0.066	Q9NHP8.pdb.gz	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
8	AFDB:E9Q7M2	0.166	0.054	3.488E-1	769	0.127	0.034	E9Q7M2.pdb.gz	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
9	AFDB:Q42139	0.162	0.153	3.488E-1	219	0.132	0.123	Q42139.pdb.gz	Q42139_ARATH AT4g32260/F10M6_100 OS=Arabidopsis thaliana OX=3702 GN=PDE334 PE=1 SV=2
10	AFDB:Q4GYP2	0.176	0.150	3.488E-1	252	0.122	0.099	Q4GYP2.pdb.gz	Q4GYP2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3310 PE=4 SV=1
11	AFDB:Q7LFL8	0.199	0.139	4.256E-1	322	0.146	0.093	Q7LFL8.pdb.gz	CXXC5_HUMAN CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1
12	PDB:7ungi	0.124	0.104	1.726	250	0.112	0.092	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:7btbm	0.132	0.062	3.580	469	0.117	0.051	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:4v88Ah	0.091	0.089	3.825	159	0.122	0.157	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
15	PDB:7rroi	0.120	0.106	4.667	235	0.151	0.132	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7wtxt	0.093	0.138	4.987	132	0.141	0.220	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:5ganG	0.155	0.115	5.329	318	0.132	0.085	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
18	PDB:7kpxC	0.114	0.025	6.503	1352	0.068	0.010	7kpxC.pdb.gz
19	PDB:3j79F	0.160	0.097	6.949	390	0.093	0.049	3j79F.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
20	PDB:5datSM	0.099	0.117	6.949	159	0.112	0.145	5datSM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41236	2.87e-151	419	205	1.000	1.000	IPP2_HUMAN Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2
2	Q6NXS1	7.77e-138	385	205	0.956	0.956	IPP2B_HUMAN Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2
3	P11845	1.16e-131	370	205	0.917	0.917	IPP2_RABIT Protein phosphatase inhibitor 2 OS=Oryctolagus cuniculus OX=9986 GN=PPP1R2 PE=1 SV=3
4	P50411	8.95e-121	342	205	0.849	0.849	IPP2_RAT Protein phosphatase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Ppp1r2 PE=1 SV=2
5	Q9DCL8	6.10e-116	330	206	0.844	0.840	IPP2_MOUSE Protein phosphatase inhibitor 2 OS=Mus musculus OX=10090 GN=Ppp1r2 PE=1 SV=3
6	O14990	1.33e-41	141	202	0.420	0.426	IPP2C_HUMAN Protein phosphatase inhibitor 2 family member C OS=Homo sapiens OX=9606 GN=PPP1R2C PE=1 SV=1
7	Q9N537	6.72e-21	87.8	193	0.249	0.264	Q9N537_CAEEL Protein phosphatase inhibitor 2 OS=Caenorhabditis elegans OX=6239 GN=szy-2 PE=1 SV=2
8	Q9V3C7	6.24e-20	85.5	205	0.302	0.302	Q9V3C7_DROME Inhibitor-2 OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
9	A8JNP7	7.27e-19	84.7	310	0.302	0.200	A8JNP7_DROME Inhibitor-2, isoform B OS=Drosophila melanogaster OX=7227 GN=I-2 PE=1 SV=1
10	C0H480	0.001	40.0	144	0.190	0.271	C0H480_PLAF7 Protein phosphatase inhibitor 2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320000 PE=1 SV=1
11	P41818	0.18	34.3	229	0.185	0.166	GLC8_YEAST Protein GLC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC8 PE=1 SV=1
12	E9PFK5	1.5	32.0	788	0.146	0.038	E9PFK5_HUMAN NOP14 nucleolar protein OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=1
13	P78316	1.6	32.0	857	0.146	0.035	NOP14_HUMAN Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14 PE=1 SV=3
14	O27552	3.4	31.2	937	0.137	0.030	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1
15	Q57ZN4	6.6	30.0	1102	0.073	0.014	Q57ZN4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.110 PE=4 SV=1
16	A0A8I6GFN0	8.9	29.6	2477	0.078	0.006	A0A8I6GFN0_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=4 SV=1
17	F1LNJ1	9.2	29.6	2526	0.078	0.006	F1LNJ1_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Lrrk2 PE=1 SV=3
18	Q5S006	9.5	29.6	2527	0.078	0.006	LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04979 IPP-2	3.6e-36	136.3	Protein phosphatase inhibitor 2 (IPP-2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484580

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326031	0.985	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
2	9606.ENSP00000341779	0.985	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
3	9606.ENSP00000378769	0.973	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
4	9606.ENSP00000365963	0.950	Protein phosphatase 1 regulatory subunit 11
5	9606.ENSP00000234038	0.940	Protein phosphatase 1 regulatory subunit 7
6	9606.ENSP00000324806	0.833	Glycogen synthase kinase-3 beta
7	9606.ENSP00000257905	0.812	Protein phosphatase 1 regulatory subunit 1A
8	9606.ENSP00000323313	0.693	Protein disulfide-isomerase A5
9	9606.ENSP00000311677	0.688	Nuclear inhibitor of protein phosphatase 1
10	9606.ENSP00000297293	0.678	Serine/threonine-protein kinase LMTK2
11	9606.ENSP00000284601	0.667	Protein phosphatase 1 regulatory subunit 3A
12	9606.ENSP00000363634	0.622	Thioredoxin domain-containing protein 8
13	9606.ENSP00000301788	0.611	DNA-directed RNA polymerase II subunit RPB7
14	9606.ENSP00000358770	0.611	STE20-like serine/threonine-protein kinase
15	9606.ENSP00000418447	0.569	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000308318	0.568	Protein phosphatase 1 regulatory subunit 3B
17	9606.ENSP00000360035	0.568	Protein phosphatase 1 regulatory subunit 3D
18	9606.ENSP00000274532	0.554	T-cell immunoglobulin and mucin domain-containing protein 4
19	9606.ENSP00000478767	0.514	Neurabin-2
20	9606.ENSP00000317904	0.512	Glycogen [starch] synthase, muscle

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004864	0.997	protein phosphatase inhibitor activity
GO:0019899	0.876	enzyme binding
GO:0008157	0.705	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0044237	0.983	cellular metabolic process
GO:0050794	0.970	regulation of cellular process
GO:0019222	0.899	regulation of metabolic process
GO:0065009	0.891	regulation of molecular function
GO:0031323	0.854	regulation of cellular metabolic process
GO:0051174	0.828	regulation of phosphorus metabolic process
GO:0060255	0.816	regulation of macromolecule metabolic process
GO:0080090	0.801	regulation of primary metabolic process
GO:0051171	0.799	regulation of nitrogen compound metabolic process
GO:0048519	0.796	negative regulation of biological process
GO:0019220	0.795	regulation of phosphate metabolic process
GO:0044092	0.764	negative regulation of molecular function
GO:0035305	0.762	negative regulation of dephosphorylation
GO:0031399	0.759	regulation of protein modification process
GO:0071704	0.758	organic substance metabolic process
GO:0035304	0.747	regulation of protein dephosphorylation
GO:0031400	0.669	negative regulation of protein modification process
GO:0006091	0.642	generation of precursor metabolites and energy
GO:0044238	0.500	primary metabolic process
GO:0006807	0.464	nitrogen compound metabolic process
GO:0043170	0.422	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0043226	0.995	organelle
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:1902494	0.962	catalytic complex
GO:0005829	0.943	cytosol
GO:0008287	0.940	protein serine/threonine phosphatase complex
GO:0030054	0.916	cell junction
GO:0005634	0.826	nucleus
GO:0070013	0.748	intracellular organelle lumen
GO:0031981	0.741	nuclear lumen
GO:0099080	0.700	supramolecular complex
GO:0000164	0.688	protein phosphatase type 1 complex
GO:0045202	0.572	synapse
GO:0042995	0.570	cell projection
GO:0099081	0.561	supramolecular polymer
GO:0099512	0.531	supramolecular fiber
GO:0120025	0.525	plasma membrane bounded cell projection
GO:0030427	0.458	site of polarized growth
GO:0043005	0.399	neuron projection
GO:0043292	0.390	contractile fiber
GO:0098978	0.389	glutamatergic synapse
GO:0036477	0.379	somatodendritic compartment
GO:0098723	0.367	skeletal muscle myofibril
GO:0030425	0.345	dendrite
GO:0098794	0.341	postsynapse
GO:0030424	0.326	axon
GO:0044309	0.317	neuron spine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]