StarFunc result for job id P41238

User Input

>input (236 residues)
MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTN
HVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLF
WHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYAL
ELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41238	1.000	1.000	1.999E-53	236	1.000	1.000	P41238.pdb.gz	ABEC1_HUMAN C->U-editing enzyme APOBEC-1 OS=Homo sapiens OX=9606 GN=APOBEC1 PE=1 SV=3
2	PDB:6x91H	0.892	0.385	6.715E-40	558	0.898	0.380	6x91H.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
3	AFDB:P38483	0.916	0.944	1.809E-38	229	0.674	0.694	P38483.pdb.gz	ABEC1_RAT C->U-editing enzyme APOBEC-1 OS=Rattus norvegicus OX=10116 GN=Apobec1 PE=1 SV=1
4	PDB:6x91A	0.889	0.362	6.126E-37	592	0.898	0.358	6x91A.pdb.gz	The structure of APOBEC1 and insights into its RNA and DNA substrate selectivity.
5	AFDB:Q9GZX7	0.649	0.767	6.849E-17	198	0.208	0.247	Q9GZX7.pdb.gz	AICDA_HUMAN Single-stranded DNA cytosine deaminase OS=Homo sapiens OX=9606 GN=AICDA PE=1 SV=1
6	AFDB:Q9NRW3	0.654	0.806	1.105E-16	190	0.208	0.258	Q9NRW3.pdb.gz	ABC3C_HUMAN DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2
7	AFDB:Q4VDN5	0.620	0.754	1.245E-16	192	0.225	0.276	Q4VDN5.pdb.gz	AB3CA_FELCA DNA dC->dU-editing enzyme APOBEC-3Ca OS=Felis catus OX=9685 GN=APOBEC3CA PE=1 SV=1
8	AFDB:B3DGZ0	0.639	0.713	2.404E-16	210	0.199	0.224	B3DGZ0.pdb.gz
9	AFDB:Q99J72	0.636	0.347	2.876E-16	440	0.216	0.116	Q99J72.pdb.gz	ABEC3_MOUSE DNA dC->dU-editing enzyme APOBEC-3 OS=Mus musculus OX=10090 GN=Apobec3 PE=1 SV=3
10	PDB:3vm8A	0.646	0.808	4.095E-16	187	0.203	0.257	3vm8A.pdb.gz	Crystal structure of the human APOBEC3C having HIV-1 Vif-binding interface
11	AFDB:Q8IUX4	0.649	0.417	8.958E-16	373	0.216	0.137	Q8IUX4.pdb.gz	ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3
12	AFDB:B0QYD3	0.648	0.321	1.629E-15	490	0.220	0.106	B0QYD3.pdb.gz	B0QYD3_HUMAN Apolipoprotein B mRNA editing enzyme catalytic subunit 3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
13	AFDB:Q7YR24	0.650	0.409	1.836E-15	384	0.237	0.146	Q7YR24.pdb.gz	ABC3G_PANTR DNA dC->dU-editing enzyme APOBEC-3G OS=Pan troglodytes OX=9598 GN=APOBEC3G PE=1 SV=2
14	PDB:6b0bA	0.561	0.725	4.887E-12	180	0.174	0.228	6b0bA.pdb.gz	The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
15	PDB:7d3vB	0.556	0.647	1.520E-9	199	0.199	0.236	7d3vB.pdb.gz	Non-specific and specific interactions work cooperatively to promote cytidine deamination catalyzed by APOBEC3
16	PDB:3g8qA	0.262	0.228	1.426E-3	278	0.110	0.094	3g8qA.pdb.gz	A cytidine deaminase edits C to U in transfer RNAs in Archaea
17	PDB:2w4lE	0.300	0.418	2.041E-3	162	0.097	0.142	2w4lE.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
18	PDB:2w4lC	0.297	0.464	4.440E-3	142	0.089	0.148	2w4lC.pdb.gz	The Crystal Structure of Human Dcmp Deaminase
19	PDB:1ox7B	0.268	0.370	6.748E-3	161	0.097	0.143	1ox7B.pdb.gz	The 1.14 a crystal structure of yeast Cytosine deaminase. Evolution of nucleotide salvage enzymes and implications for genetic chemotherapy.
20	PDB:7bv5C	0.256	0.219	2.369E-2	284	0.068	0.056	7bv5C.pdb.gz	Crystal structure of the yeast heterodimeric ADAT2/3 deaminase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41238	1.12e-179	493	236	1.000	1.000	ABEC1_HUMAN C->U-editing enzyme APOBEC-1 OS=Homo sapiens OX=9606 GN=APOBEC1 PE=1 SV=3
2	P51908	5.89e-120	342	229	0.686	0.707	ABEC1_MOUSE C->U-editing enzyme APOBEC-1 OS=Mus musculus OX=10090 GN=Apobec1 PE=1 SV=1
3	P38483	4.47e-115	330	229	0.674	0.694	ABEC1_RAT C->U-editing enzyme APOBEC-1 OS=Rattus norvegicus OX=10116 GN=Apobec1 PE=1 SV=1
4	Q9GZX7	7.02e-19	83.6	198	0.186	0.222	AICDA_HUMAN Single-stranded DNA cytosine deaminase OS=Homo sapiens OX=9606 GN=AICDA PE=1 SV=1
5	B0QYD3	1.04e-18	86.7	490	0.246	0.118	B0QYD3_HUMAN Apolipoprotein B mRNA editing enzyme catalytic subunit 3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
6	Q9WVE0	1.06e-18	82.8	198	0.169	0.202	AICDA_MOUSE Single-stranded DNA cytosine deaminase OS=Mus musculus OX=10090 GN=Aicda PE=1 SV=1
7	Q9UH17	1.20e-18	85.9	382	0.246	0.152	ABC3B_HUMAN DNA dC->dU-editing enzyme APOBEC-3B OS=Homo sapiens OX=9606 GN=APOBEC3B PE=1 SV=1
8	Q8IUX4	2.10e-18	85.1	373	0.174	0.110	ABC3F_HUMAN DNA dC->dU-editing enzyme APOBEC-3F OS=Homo sapiens OX=9606 GN=APOBEC3F PE=1 SV=3
9	Q9NRW3	1.28e-17	79.7	190	0.157	0.195	ABC3C_HUMAN DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2
10	Q7YR24	2.58e-17	82.0	384	0.246	0.151	ABC3G_PANTR DNA dC->dU-editing enzyme APOBEC-3G OS=Pan troglodytes OX=9598 GN=APOBEC3G PE=1 SV=2
11	Q9HC16	5.31e-17	81.3	384	0.229	0.141	ABC3G_HUMAN DNA dC->dU-editing enzyme APOBEC-3G OS=Homo sapiens OX=9606 GN=APOBEC3G PE=1 SV=1
12	Q7YR25	7.04e-17	80.9	377	0.216	0.135	ABC3G_CHLAE DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Chlorocebus aethiops OX=9534 GN=APOBEC3G PE=1 SV=1
13	Q4VDN5	1.26e-16	77.4	192	0.153	0.188	AB3CA_FELCA DNA dC->dU-editing enzyme APOBEC-3Ca OS=Felis catus OX=9685 GN=APOBEC3CA PE=1 SV=1
14	Q96AK3	2.60e-16	79.3	386	0.169	0.104	ABC3D_HUMAN DNA dC->dU-editing enzyme APOBEC-3D OS=Homo sapiens OX=9606 GN=APOBEC3D PE=1 SV=1
15	Q5YF88	3.43e-16	76.6	210	0.144	0.162	Q5YF88_DANRE Activation-induced cytidine deaminase OS=Danio rerio OX=7955 GN=aicda PE=2 SV=1
16	Q7YR23	2.95e-15	75.9	370	0.157	0.100	ABC3G_MACMU DNA dC->dU-editing enzyme APOBEC-3G (Fragment) OS=Macaca mulatta OX=9544 GN=APOBEC3G PE=1 SV=1
17	Q99J72	1.73e-14	73.9	440	0.161	0.086	ABEC3_MOUSE DNA dC->dU-editing enzyme APOBEC-3 OS=Mus musculus OX=10090 GN=Apobec3 PE=1 SV=3
18	A0A0K0MJ49	9.57e-14	69.7	199	0.208	0.246	A0A0K0MJ49_HUMAN APOBEC3A OS=Homo sapiens OX=9606 GN=APOBEC3A PE=2 SV=1
19	P31941	9.57e-14	69.7	199	0.208	0.246	ABC3A_HUMAN DNA dC->dU-editing enzyme APOBEC-3A OS=Homo sapiens OX=9606 GN=APOBEC3A PE=1 SV=3
20	Q19Q52	1.05e-13	69.7	210	0.169	0.190	ABC3H_MACMU DNA dC->dU-editing enzyme APOBEC-3H OS=Macaca mulatta OX=9544 GN=APOBEC3H PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18769 APOBEC1	3.9e-51	182.7	APOBEC1
2	PF18772 APOBEC2	2.2e-31	120.7	APOBEC2
3	PF18771 APOBEC3	1.3e-22	91.8	APOBEC3
4	PF18775 APOBEC4	1.4e-26	103.7	APOBEC4
5	PF18774 APOBEC4_like	4.8e-53	190.0	APOBEC4-like -AID/APOBEC-deaminase
6	PF05240 APOBEC_C	8.7e-20	81.9	APOBEC-like C-terminal domain
7	PF08210 APOBEC_N	2.3e-29	114.1	APOBEC-like N-terminal domain
8	PF00383 dCMP_cyt_deam_1	16	16.8	Cytidine and deoxycytidylate deaminase zinc-binding region
9	PF18778 NAD1	1e-44	164.2	Novel AID APOBEC clade 1
10	PF18782 NAD2	2.7e-29	114.1	Novel AID APOBEC clade 2
11	PF18750 SNAD4	2.3e-36	135.8	Secreted Novel AID/APOBEC-like Deaminase 4
12	PF14424 Toxin-deaminase	5.4e+02	12.0	The BURPS668_1122 family of deaminases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000229304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378868	0.992	APOBEC1 complementation factor
2	9606.ENSP00000310622	0.988	Putative C->U-editing enzyme APOBEC-4
3	9606.ENSP00000244669	0.948	C->U-editing enzyme APOBEC-2
4	9606.ENSP00000384359	0.929	DNA dC->dU-editing enzyme APOBEC-3A
5	9606.ENSP00000327459	0.925	DNA dC->dU-editing enzyme APOBEC-3B
6	9606.ENSP00000385741	0.924	DNA dC->dU-editing enzyme APOBEC-3H
7	9606.ENSP00000355340	0.923	DNA dC->dU-editing enzyme APOBEC-3C
8	9606.ENSP00000233242	0.828	Apolipoprotein B-100
9	9606.ENSP00000443926	0.791	CUGBP Elav-like family member 2
10	9606.ENSP00000358635	0.787	Heterogeneous nuclear ribonucleoprotein Q
11	9606.ENSP00000364212	0.785	Cytidine deaminase
12	9606.ENSP00000351108	0.753	Heterogeneous nuclear ribonucleoprotein A/B
13	9606.ENSP00000414398	0.727	DnaJ homolog subfamily B member 11
14	9606.ENSP00000483254	0.701	Heterogeneous nuclear ribonucleoprotein D-like
15	9606.ENSP00000216133	0.699	Chromobox protein homolog 7
16	9606.ENSP00000384490	0.692	Chromobox protein homolog 6
17	9606.ENSP00000371212	0.667	RNA-binding protein 47
18	9606.ENSP00000242576	0.664	Uracil-DNA glycosylase
19	9606.ENSP00000357459	0.635	Double-stranded RNA-specific adenosine deaminase
20	9606.ENSP00000376611	0.613	G/T mismatch-specific thymine DNA glycosylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004126	1.000	cytidine deaminase activity
GO:0043169	0.995	cation binding
GO:0008270	0.989	zinc ion binding
GO:0003676	0.976	nucleic acid binding
GO:0003723	0.974	RNA binding
GO:0003729	0.649	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006139	0.992	nucleobase-containing compound metabolic process
GO:0048523	0.990	negative regulation of cellular process
GO:0043170	0.988	macromolecule metabolic process
GO:0048518	0.985	positive regulation of biological process
GO:0090304	0.983	nucleic acid metabolic process
GO:0051252	0.982	regulation of RNA metabolic process
GO:0051172	0.972	negative regulation of nitrogen compound metabolic process
GO:0031324	0.972	negative regulation of cellular metabolic process
GO:0009451	0.971	RNA modification
GO:0010605	0.970	negative regulation of macromolecule metabolic process
GO:0016071	0.969	mRNA metabolic process
GO:0009893	0.968	positive regulation of metabolic process
GO:0009894	0.964	regulation of catabolic process
GO:0010604	0.960	positive regulation of macromolecule metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0016553	0.957	base conversion or substitution editing
GO:0045934	0.950	negative regulation of nucleobase-containing compound metabolic process
GO:0016556	0.927	mRNA modification
GO:1903311	0.925	regulation of mRNA metabolic process
GO:0031329	0.917	regulation of cellular catabolic process
GO:1902369	0.886	negative regulation of RNA catabolic process
GO:1903312	0.846	negative regulation of mRNA metabolic process
GO:0010628	0.810	positive regulation of gene expression
GO:0061013	0.793	regulation of mRNA catabolic process
GO:1902373	0.690	negative regulation of mRNA catabolic process
GO:0050896	0.456	response to stimulus
GO:0006259	0.325	DNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005654	0.989	nucleoplasm
GO:0032991	0.982	protein-containing complex
GO:0140513	0.740	nuclear protein-containing complex
GO:1902494	0.702	catalytic complex
GO:0045293	0.361	mRNA editing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16069	1.000	cytidine + H(+) + H2O = NH4(+) + uridine
EC:3.5.4.5	1.000	cytidine deaminase.

[back to server]