StarFunc result for job id P41240

User Input

>input (450 residues)
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAAMRPSFLQLREQLEHIKTHELHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32577	0.959	0.959	7.106E-89	450	0.984	0.984	P32577.pdb.gz	CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1
2	AFDB:A0JMN4	0.985	0.985	2.371E-83	450	0.858	0.858	A0JMN4.pdb.gz	A0JMN4_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:154049 PE=1 SV=1
3	PDB:1k9aB	0.919	0.937	1.171E-77	441	0.960	0.980	1k9aB.pdb.gz
4	AFDB:P42679	0.884	0.789	3.283E-61	507	0.522	0.464	P42679.pdb.gz	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
5	AFDB:G5ECJ6	0.568	0.475	9.645E-55	539	0.498	0.416	G5ECJ6.pdb.gz	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
6	AFDB:Q8INJ8	0.626	0.283	1.930E-52	1052	0.524	0.224	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
7	AFDB:A0A024R8E2	0.575	0.239	4.609E-47	1130	0.387	0.154	A0A024R8E2.pdb.gz
8	AFDB:P03949	0.578	0.221	9.517E-47	1224	0.396	0.145	P03949.pdb.gz	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
9	AFDB:P00522	0.585	0.172	1.487E-46	1620	0.396	0.110	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
10	AFDB:F7BN18	0.574	0.239	2.197E-46	1128	0.380	0.152	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
11	AFDB:P42684	0.585	0.234	3.433E-46	1182	0.400	0.152	P42684.pdb.gz	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
12	PDB:2h8hA	0.533	0.539	5.786E-40	445	0.404	0.409	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.505	0.412	9.580E-33	555	0.353	0.286	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.507	0.417	3.542E-30	551	0.291	0.238	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.464	0.713	5.423E-18	283	0.173	0.276	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:4krcA	0.489	0.726	2.545E-16	297	0.144	0.219	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:1unlA	0.491	0.742	3.364E-16	292	0.133	0.205	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
18	PDB:5ufuA	0.498	0.601	3.364E-16	369	0.144	0.176	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:4zhxA	0.496	0.543	3.557E-16	409	0.140	0.154	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:2qkwB	0.476	0.710	6.214E-16	292	0.158	0.243	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JMN4	0.0	828	450	0.858	0.858	A0JMN4_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:154049 PE=1 SV=1
2	P32577	0.0	929	450	0.984	0.984	CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus OX=10116 GN=Csk PE=1 SV=1
3	P41240	0.0	940	450	1.000	1.000	CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1
4	P41241	0.0	934	450	0.991	0.991	CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus OX=10090 GN=Csk PE=1 SV=2
5	P42679	8.49e-172	493	507	0.522	0.464	MATK_HUMAN Megakaryocyte-associated tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=MATK PE=1 SV=1
6	Q7KSQ2	5.74e-161	473	723	0.533	0.332	Q7KSQ2_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=1
7	Q9VGK8	2.38e-160	474	805	0.513	0.287	Q9VGK8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=3
8	Q8INJ8	5.75e-158	476	1052	0.513	0.220	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
9	G5ECJ6	1.24e-143	423	539	0.496	0.414	CSK1_CAEEL Tyrosine-protein kinase csk-1 OS=Caenorhabditis elegans OX=6239 GN=csk-1 PE=1 SV=1
10	W5U6C9	2.42e-103	318	500	0.396	0.356	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
11	Q9V9J3	4.65e-103	318	517	0.396	0.344	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
12	P03949	3.92e-101	329	1224	0.407	0.150	ABL1_CAEEL Tyrosine-protein kinase abl-1 OS=Caenorhabditis elegans OX=6239 GN=abl-1 PE=1 SV=4
13	P00522	8.29e-101	332	1620	0.396	0.110	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
14	P42684	1.25e-99	325	1182	0.393	0.150	ABL2_HUMAN Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1
15	Q4JIM5	3.89e-99	323	1182	0.393	0.150	ABL2_MOUSE Tyrosine-protein kinase ABL2 OS=Mus musculus OX=10090 GN=Abl2 PE=1 SV=1
16	P00519	6.32e-98	319	1130	0.387	0.154	ABL1_HUMAN Tyrosine-protein kinase ABL1 OS=Homo sapiens OX=9606 GN=ABL1 PE=1 SV=4
17	P00520	1.00e-97	318	1123	0.384	0.154	ABL1_MOUSE Tyrosine-protein kinase ABL1 OS=Mus musculus OX=10090 GN=Abl1 PE=1 SV=3
18	Q2PYT4	1.06e-97	319	1143	0.384	0.151	Q2PYT4_RAT Tyrosine-protein kinase (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
19	E9PT20	1.11e-97	318	1143	0.384	0.151	E9PT20_RAT Tyrosine-protein kinase OS=Rattus norvegicus OX=10116 GN=Abl1 PE=3 SV=1
20	P06239	1.84e-97	303	509	0.393	0.348	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4.1e+02	11.5	ABC1 atypical kinase-like domain
2	PF01636 APH	1.9e+02	13.3	Phosphotransferase enzyme family
3	PF00069 Pkinase	4.1e-41	152.7	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.7e-85	297.4	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	2.2e-21	87.0	SH2 domain
6	PF00018 SH3_1	6.9e-10	49.7	SH3 domain
7	PF07653 SH3_2	0.01	27.0	Variant SH3 domain
8	PF08239 SH3_3	5.6e+02	12.4	Bacterial SH3 domain
9	PF14604 SH3_9	0.00042	31.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010374171.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010376782.1	0.996	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 isoform X1
2	61622.XP_010366586.1	0.966	Paxillin
3	61622.XP_010370280.1	0.946	Tyrosine-protein phosphatase non-receptor type 22
4	61622.XP_010353661.1	0.944	Proto-oncogene tyrosine-protein kinase Src
5	61622.XP_010377566.1	0.906	Docking protein 1
6	61622.XP_010378850.1	0.884	Epidermal growth factor receptor isoform X1
7	61622.XP_010381274.1	0.862	BCAR1, Cas family scaffolding protein
8	61622.XP_010369949.1	0.859	Tyrosine-protein kinase Fyn isoform X1
9	61622.XP_010360579.1	0.858	Transforming growth factor beta-1-induced transcript 1 protein
10	61622.XP_010353207.1	0.852	YES proto-oncogene 1, Src family tyrosine kinase
11	61622.XP_010378403.1	0.813	PEAK1 related kinase activating pseudokinase 1
12	61622.XP_010384591.1	0.800	Tyrosine-protein phosphatase non-receptor type 12 isoform X1
13	61622.XP_010384216.1	0.799	CD4 molecule
14	61622.XP_010356455.1	0.794	Fyn related Src family tyrosine kinase
15	61622.XP_010377025.1	0.790	Tyrosine-protein phosphatase non-receptor type 11 isoform X1
16	61622.XP_010357283.1	0.786	KIT proto-oncogene receptor tyrosine kinase
17	61622.XP_010362739.1	0.770	Belongs to the integrin beta chain family.
18	61622.XP_010370100.1	0.767	CD247 molecule
19	61622.XP_010376724.1	0.762	CD8a molecule
20	61622.XP_010352349.1	0.754	Tyrosine-protein kinase Lck

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0019900	0.918	kinase binding
GO:0019901	0.891	protein kinase binding
GO:0005102	0.432	signaling receptor binding
GO:0004715	0.374	non-membrane spanning protein tyrosine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.985	response to stimulus
GO:0051716	0.974	cellular response to stimulus
GO:0048518	0.970	positive regulation of biological process
GO:0071704	0.967	organic substance metabolic process
GO:0044237	0.940	cellular metabolic process
GO:0043170	0.934	macromolecule metabolic process
GO:0006793	0.934	phosphorus metabolic process
GO:0007154	0.919	cell communication
GO:0023052	0.916	signaling
GO:0043412	0.915	macromolecule modification
GO:0048522	0.910	positive regulation of cellular process
GO:0006807	0.890	nitrogen compound metabolic process
GO:0044238	0.886	primary metabolic process
GO:1901564	0.882	organonitrogen compound metabolic process
GO:0007165	0.870	signal transduction
GO:0006796	0.850	phosphate-containing compound metabolic process
GO:0036211	0.848	protein modification process
GO:0048519	0.830	negative regulation of biological process
GO:0002682	0.782	regulation of immune system process
GO:0048583	0.762	regulation of response to stimulus
GO:0032501	0.746	multicellular organismal process
GO:0032502	0.741	developmental process
GO:0048856	0.716	anatomical structure development
GO:0019222	0.698	regulation of metabolic process
GO:0060255	0.667	regulation of macromolecule metabolic process
GO:0016310	0.649	phosphorylation
GO:0006468	0.610	protein phosphorylation
GO:0007166	0.597	cell surface receptor signaling pathway
GO:0080090	0.576	regulation of primary metabolic process
GO:0051171	0.529	regulation of nitrogen compound metabolic process
GO:0031323	0.512	regulation of cellular metabolic process
GO:0048523	0.488	negative regulation of cellular process
GO:0051239	0.463	regulation of multicellular organismal process
GO:0048584	0.463	positive regulation of response to stimulus
GO:0023051	0.448	regulation of signaling
GO:0010646	0.447	regulation of cell communication
GO:0071840	0.431	cellular component organization or biogenesis
GO:0042221	0.424	response to chemical
GO:0009966	0.419	regulation of signal transduction
GO:0065009	0.414	regulation of molecular function
GO:0010468	0.402	regulation of gene expression
GO:0051246	0.400	regulation of protein metabolic process
GO:1902531	0.398	regulation of intracellular signal transduction
GO:0023056	0.372	positive regulation of signaling
GO:0010647	0.372	positive regulation of cell communication
GO:0010604	0.371	positive regulation of macromolecule metabolic process
GO:0009967	0.345	positive regulation of signal transduction
GO:0007275	0.344	multicellular organism development
GO:0050776	0.341	regulation of immune response
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0031325	0.339	positive regulation of cellular metabolic process
GO:0001932	0.334	regulation of protein phosphorylation
GO:0016043	0.327	cellular component organization
GO:0042127	0.326	regulation of cell population proliferation
GO:0070887	0.326	cellular response to chemical stimulus
GO:0002376	0.324	immune system process
GO:0050790	0.306	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043227	0.991	membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0031982	0.910	vesicle
GO:0030054	0.859	cell junction
GO:0070161	0.843	anchoring junction
GO:0005576	0.685	extracellular region
GO:1903561	0.668	extracellular vesicle
GO:0070062	0.641	extracellular exosome
GO:0098857	0.531	membrane microdomain
GO:0005634	0.480	nucleus
GO:0045121	0.402	membrane raft
GO:0005911	0.329	cell-cell junction
GO:0031410	0.322	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.374	non-specific protein-tyrosine kinase.

[back to server]