StarFunc result for job id P41250

User Input

>input (739 residues)
MPSPRPVLLRGARAALLLLLPPRLLARPSLLLRRSLSAASCPPISLPAAASRSSMDGAGA
EEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVD
RAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDC
TMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEME
SVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPET
AQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEK
DHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKV
GISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPL
VAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEF
TIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDE
QRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYAR
TDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVE
ARYPLFEGQETGKKETIEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41250	1.000	1.000	0.000	739	1.000	1.000	P41250.pdb.gz	GARS_HUMAN Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3
2	AFDB:Q4V9I4	0.924	0.894	0.000	764	0.824	0.797	Q4V9I4.pdb.gz
3	PDB:4kqeA	0.717	0.880	1.668E-98	597	0.805	0.997	4kqeA.pdb.gz
4	AFDB:Q9VUK8	0.895	0.865	1.169E-95	765	0.568	0.549	Q9VUK8.pdb.gz	GARS_DROME Glycine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GlyRS PE=1 SV=1
5	PDB:2zt5A	0.668	0.919	1.345E-87	530	0.716	0.998	2zt5A.pdb.gz	Crystal structures and biochemical analyses suggest unique mechanism and role for human GlyRS in Ap4A homeostasis
6	PDB:5e6mA	0.695	0.986	4.015E-82	519	0.702	1.000	5e6mA.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
7	AFDB:O23627	0.776	0.786	7.870E-82	729	0.447	0.453	O23627.pdb.gz	SYGM1_ARATH Glycine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=At1g29880 PE=1 SV=1
8	PDB:5e6mB	0.634	0.923	1.202E-81	506	0.675	0.986	5e6mB.pdb.gz	Crystal Structure of the Wild-Type Human GlyRS Bound with tRNA(Gly) in a Productive Conformation
9	AFDB:Q54PF9	0.763	0.829	2.959E-79	678	0.425	0.463	Q54PF9.pdb.gz	Q54PF9_DICDI glycine--tRNA ligase OS=Dictyostelium discoideum OX=44689 GN=glyS PE=3 SV=1
10	AFDB:Q10179	0.774	0.873	9.581E-77	652	0.413	0.468	Q10179.pdb.gz	SYG_SCHPO Putative glycine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grs1 PE=3 SV=1
11	AFDB:Q06817	0.762	0.903	1.812E-75	618	0.395	0.472	Q06817.pdb.gz	SYG2_YEAST Glycine--tRNA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRS2 PE=1 SV=1
12	AFDB:P38088	0.753	0.804	1.330E-74	690	0.406	0.435	P38088.pdb.gz	SYG_YEAST Glycine--tRNA ligase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRS1 PE=1 SV=3
13	AFDB:Q383W5	0.780	0.918	8.144E-71	624	0.371	0.439	Q383W5.pdb.gz	Q383W5_TRYB2 glycine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1400 PE=3 SV=1
14	AFDB:Q8ILP6	0.717	0.602	8.144E-71	889	0.398	0.331	Q8ILP6.pdb.gz	Q8ILP6_PLAF7 glycine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1420400 PE=3 SV=2
15	PDB:1atiA	0.488	0.810	4.966E-31	437	0.219	0.371	1atiA.pdb.gz	Crystal structure of glycyl-tRNA synthetase from Thermus thermophilus.
16	PDB:1g5hD	0.404	0.700	6.857E-19	415	0.120	0.214	1g5hD.pdb.gz
17	PDB:2g4cA	0.399	0.723	7.132E-18	397	0.112	0.209	2g4cA.pdb.gz
18	PDB:1nj1A	0.411	0.639	6.388E-17	463	0.100	0.160	1nj1A.pdb.gz	The structural basis of cysteine aminoacylation of tRNAPro by prolyl-tRNA synthetases
19	PDB:4ztuB	0.393	0.763	5.722E-16	363	0.107	0.218	4ztuB.pdb.gz	Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
20	PDB:1qf6A	0.404	0.461	1.800E-15	641	0.100	0.115	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O23627	0.0	679	729	0.467	0.473	SYGM1_ARATH Glycine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=At1g29880 PE=1 SV=1
2	P38088	0.0	615	690	0.413	0.442	SYG_YEAST Glycine--tRNA ligase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRS1 PE=1 SV=3
3	P41250	0.0	1536	739	1.000	1.000	GARS_HUMAN Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3
4	Q06817	0.0	607	618	0.394	0.471	SYG2_YEAST Glycine--tRNA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRS2 PE=1 SV=1
5	Q10179	0.0	631	652	0.415	0.471	SYG_SCHPO Putative glycine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grs1 PE=3 SV=1
6	Q54PF9	0.0	656	678	0.422	0.460	Q54PF9_DICDI glycine--tRNA ligase OS=Dictyostelium discoideum OX=44689 GN=glyS PE=3 SV=1
7	Q9CZD3	0.0	1403	729	0.913	0.926	GARS_MOUSE Glycine--tRNA ligase OS=Mus musculus OX=10090 GN=Gars1 PE=1 SV=1
8	Q9VUK8	0.0	865	765	0.560	0.541	GARS_DROME Glycine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=GlyRS PE=1 SV=1
9	Q383W5	2.94e-178	525	624	0.372	0.441	Q383W5_TRYB2 glycine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1400 PE=3 SV=1
10	Q8ILP6	2.31e-139	434	889	0.315	0.262	Q8ILP6_PLAF7 glycine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1420400 PE=3 SV=2
11	P56206	2.06e-56	202	506	0.223	0.326	SYG_THET8 Glycine--tRNA ligase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=glyQS PE=1 SV=3
12	P9WFV6	1.56e-44	168	463	0.161	0.257	SYG_MYCTO Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glyQS PE=3 SV=1
13	P9WFV7	1.56e-44	168	463	0.161	0.257	SYG_MYCTU Glycine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glyQS PE=1 SV=1
14	O74765	0.001	44.3	425	0.026	0.045	SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC24C6.03 PE=3 SV=1
15	Q8CFI5	0.012	41.2	475	0.028	0.044	SYPM_MOUSE Probable proline--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Pars2 PE=1 SV=2
16	P39965	0.017	40.8	576	0.024	0.031	SYPM_YEAST Probable proline--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM10 PE=1 SV=1
17	Q980D1	0.039	39.3	386	0.028	0.054	SYTE_SACS2 Threonine--tRNA ligase editing subunit OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=thrS-ed PE=1 SV=1
18	Q8CGC7	0.073	39.3	1512	0.038	0.019	SYEP_MOUSE Bifunctional glutamate/proline--tRNA ligase OS=Mus musculus OX=10090 GN=Eprs1 PE=1 SV=4
19	P16659	0.095	38.5	572	0.039	0.051	SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=proS PE=1 SV=4
20	Q9W6G7	0.16	37.7	463	0.023	0.037	DPOG2_XENLA DNA polymerase subunit gamma-2, mitochondrial OS=Xenopus laevis OX=8355 GN=polg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	1.9e-20	84.1	Anticodon binding domain
2	PF00587 tRNA-synt_2b	2.5e-06	39.1	tRNA synthetase class II core domain (G, H, P, S and T)
3	PF00458 WHEP-TRS	9.2e-07	40.2	WHEP-TRS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364794	0.997	Isoleucine--tRNA ligase, cytoplasmic
2	9606.ENSP00000261772	0.996	Alanine--tRNA ligase, cytoplasmic
3	9606.ENSP00000355890	0.994	Bifunctional glutamate/proline--tRNA ligase
4	9606.ENSP00000417901	0.990	Gephyrin
5	9606.ENSP00000362576	0.989	Tyrosine--tRNA ligase, cytoplasmic
6	9606.ENSP00000387710	0.980	Threonine--tRNA ligase, cytoplasmic
7	9606.ENSP00000256854	0.972	Asparagine--tRNA ligase, cytoplasmic
8	9606.ENSP00000234677	0.970	Serine--tRNA ligase, cytoplasmic
9	9606.ENSP00000338093	0.970	Probable threonine--tRNA ligase 2, cytoplasmic
10	9606.ENSP00000325448	0.966	Lysine--tRNA ligase
11	9606.ENSP00000262027	0.955	Methionine--tRNA ligase, cytoplasmic
12	9606.ENSP00000265371	0.951	Neuropilin-1
13	9606.ENSP00000307567	0.951	Glutamine--tRNA ligase
14	9606.ENSP00000264161	0.947	Aspartate--tRNA ligase, cytoplasmic
15	9606.ENSP00000175506	0.945	Asparagine synthetase
16	9606.ENSP00000425634	0.945	Histidine--tRNA ligase, cytoplasmic
17	9606.ENSP00000377954	0.944	Leucine--tRNA ligase, cytoplasmic
18	9606.ENSP00000369897	0.929	Cysteine--tRNA ligase, cytoplasmic
19	9606.ENSP00000320658	0.919	Tyrosine--tRNA ligase, mitochondrial
20	9606.ENSP00000364815	0.919	Valine--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004820	1.000	glycine-tRNA ligase activity
GO:0046983	0.978	protein dimerization activity
GO:0016787	0.891	hydrolase activity
GO:0016818	0.875	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0042802	0.873	identical protein binding
GO:0016462	0.850	pyrophosphatase activity
GO:0004081	0.459	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043038	0.985	amino acid activation
GO:0006399	0.985	tRNA metabolic process
GO:0006418	0.981	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0005829	0.966	cytosol
GO:0070013	0.966	intracellular organelle lumen
GO:0031982	0.918	vesicle
GO:0005576	0.688	extracellular region
GO:0065010	0.674	extracellular membrane-bounded organelle
GO:0070062	0.651	extracellular exosome
GO:0012505	0.650	endomembrane system
GO:0005634	0.587	nucleus
GO:0031981	0.540	nuclear lumen
GO:0016020	0.441	membrane
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16013	1.000	ATP + glycine + tRNA(Gly) = AMP + diphosphate + glycyl-tRNA(Gly)
EC:6.1.1.14	1.000	glycine--tRNA ligase.
EC:3.-.-.-	0.891	Hydrolases.
EC:3.6.1.-	0.875	In phosphorus-containing anhydrides.
RHEA:22484	0.459	H2O + P(1),P(4)-bis(5'-guanosyl) tetraphosphate = GMP + GTP + 2 H(+)
EC:3.6.1.17	0.459	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).

[back to server]