StarFunc result for job id P41252

User Input

>input (1262 residues)
MLQQVPENINFPAEEEKILEFWTEFNCFQECLKQSKHKPKFTFYDGPPFATGLPHYGHIL
AGTIKDIVTRYAHQSGFHVDRRFGWDCHGLPVEYEIDKTLGIRGPEDVAKMGITEYNNQC
RAIVMRYSAEWKSTVSRLGRWIDFDNDYKTLYPQFMESVWWVFKQLYDKGLVYRGVKVMP
FSTACNTPLSNFESHQNYKDVQDPSVFVTFPLEEDETVSLVAWTTTPWTLPSNLAVCVNP
EMQYVKIKDVARGRLLILMEARLSALYKLESDYEILERFPGAYLKGKKYRPLFDYFLKCK
ENGAFTVLVDNYVKEEEGTGVVHQAPYFGAEDYRVCMDFNIIRKDSLPVCPVDASGCFTT
EVTDFAGQYVKDADKSIIRTLKEQGRLLVATTFTHSYPFCWRSDTPLIYKAVPSWFVRVE
NMVDQLLRNNDLCYWVPELVREKRFGNWLKDARDWTISRNRYWGTPIPLWVSDDFEEVVC
IGSVAELEELSGAKISDLHRESVDHLTIPSRCGKGSLHRISEVFDCWFESGSMPYAQVHY
PFENKREFEDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQK
MSKRKKNYPDPVSIIQKYGADALRLYLINSPVVRAENLRFKEEGVRDVLKDVLLPWYNAY
RFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVV
PRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELM
YQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKT
IPIKYPLKEIVVIHQDPEALKDIKSLEKYIIEELNVRKVTLSTDKNKYGIRLRAEPDHMV
LGKRLKGAFKAVMTSIKQLSSEELEQFQKTGTIVVEGHELHDEDIRLMYTFDQATGGTAQ
FEAHSDAQALVLLDVTPDQSMVDEGMAREVINRIQKLRKKCNLVPTDEITVYYKAKSEGT
YLNSVIESHTEFIFTTIKAPLKPYPVSPSDKVLIQEKTQLKGSELEITLTRGSSLPGPAC
AYVNLNICANGSEQGGVLLLENPKGDNRLDLLKLKSVVTSIFGVKNTELAVFHDETEIQN
QTDLLSLSGKTLCVTAGSAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPL
GQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTA
DF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7d5cA	0.698	0.952	0.000	919	0.418	0.575	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
2	AFDB:F4JLM5	0.758	0.801	0.000	1190	0.463	0.491	F4JLM5.pdb.gz	SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g10320 PE=2 SV=1
3	AFDB:O13651	0.806	0.952	0.000	1064	0.460	0.546	O13651.pdb.gz	SYIC_SCHPO Isoleucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=irs1 PE=3 SV=1
4	AFDB:P09436	0.806	0.945	0.000	1072	0.452	0.533	P09436.pdb.gz	SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILS1 PE=1 SV=1
5	AFDB:P41252	1.000	1.000	0.000	1262	1.000	1.000	P41252.pdb.gz	SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2
6	AFDB:Q38A55	0.746	0.818	0.000	1143	0.438	0.484	Q38A55.pdb.gz	Q38A55_TRYB2 isoleucine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1220 PE=3 SV=1
7	AFDB:Q6PGU7	0.856	0.850	0.000	1271	0.741	0.736	Q6PGU7.pdb.gz
8	AFDB:Q8MSW0	0.835	0.857	0.000	1229	0.524	0.538	Q8MSW0.pdb.gz	Q8MSW0_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS PE=1 SV=1
9	AFDB:P9WFV3	0.695	0.833	1.325E-101	1041	0.324	0.393	P9WFV3.pdb.gz	SYI_MYCTU Isoleucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ileS PE=1 SV=1
10	AFDB:P00956	0.569	0.747	6.441E-62	938	0.178	0.240	P00956.pdb.gz	SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=ileS PE=1 SV=5
11	AFDB:Q72AR5	0.576	0.756	1.637E-60	938	0.197	0.265	Q72AR5.pdb.gz	SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ileS PE=1 SV=1
12	PDB:6lpfB	0.400	0.490	3.975E-34	1006	0.141	0.177	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
13	PDB:3zgzD	0.355	0.499	2.981E-30	867	0.139	0.202	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
14	PDB:4ariA	0.343	0.506	2.715E-27	821	0.127	0.195	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
15	PDB:6ax8A	0.325	0.764	6.053E-16	509	0.074	0.185	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:1u0bB	0.218	0.537	1.561E-5	461	0.070	0.191	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.126	0.343	1.224E-4	375	0.036	0.123	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:7rbsB	0.054	0.355	4.828E-4	157	0.021	0.166	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
19	PDB:5yymA	0.151	0.302	1.058E-3	581	0.031	0.067	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
20	PDB:5b63C	0.128	0.251	5.883E-3	553	0.030	0.069	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSX9	0.0	2582	1242	0.984	1.000	A0A0A0MSX9_HUMAN isoleucine--tRNA ligase OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=1
2	F4JLM5	0.0	1191	1190	0.463	0.491	SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g10320 PE=2 SV=1
3	O13651	0.0	1222	1064	0.460	0.545	SYIC_SCHPO Isoleucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=irs1 PE=3 SV=1
4	P09436	0.0	1207	1072	0.454	0.535	SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILS1 PE=1 SV=1
5	P41252	0.0	2622	1262	1.000	1.000	SYIC_HUMAN Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2
6	P9WFV3	0.0	736	1041	0.328	0.398	SYI_MYCTU Isoleucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ileS PE=1 SV=1
7	Q38A55	0.0	1128	1143	0.441	0.487	Q38A55_TRYB2 isoleucine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1220 PE=3 SV=1
8	Q8BU30	0.0	2389	1262	0.906	0.906	SYIC_MOUSE Isoleucine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Iars1 PE=1 SV=2
9	Q8MSW0	0.0	1380	1229	0.532	0.546	Q8MSW0_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS PE=1 SV=1
10	Q72AR5	1.14e-97	336	938	0.207	0.278	SYI_DESVH Isoleucine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ileS PE=1 SV=1
11	Q8BIJ6	3.70e-85	302	1012	0.189	0.236	SYIM_MOUSE Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Iars2 PE=1 SV=1
12	Q9NSE4	2.23e-80	288	1012	0.193	0.240	SYIM_HUMAN Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2
13	P00956	4.47e-80	286	938	0.174	0.235	SYI_ECOLI Isoleucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=ileS PE=1 SV=5
14	Q8RXK8	7.57e-75	273	1093	0.189	0.218	SYIM_ARATH Isoleucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA2 PE=2 SV=1
15	Q9VUY4	4.72e-74	268	941	0.182	0.244	Q9VUY4_DROME isoleucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=IleRS-m PE=1 SV=2
16	Q9USL3	1.10e-70	259	973	0.189	0.246	SYIM_SCHPO Isoleucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ism1 PE=3 SV=1
17	P48526	1.33e-61	231	1002	0.174	0.220	SYIM_YEAST Isoleucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISM1 PE=1 SV=2
18	Q72E47	8.55e-54	206	884	0.166	0.238	SYV_DESVH Valine--tRNA ligase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=valS PE=1 SV=1
19	P9WFS9	2.66e-52	201	886	0.177	0.252	SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=valS PE=1 SV=2
20	F4KE63	7.21e-49	191	974	0.160	0.207	SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2247 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	1.6e-19	81.8	Anticodon-binding domain of tRNA ligase
2	PF19302 DUF5915	6.7e-20	83.0	Domain of unknown function (DUF5915)
3	PF00133 tRNA-synt_1	8.4e-253	851.7	tRNA synthetases class I (I, L, M and V)
4	PF01406 tRNA-synt_1e	2.8	18.8	tRNA synthetases class I (C) catalytic domain
5	PF09334 tRNA-synt_1g	1.2e-11	55.7	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231572	0.999	Arginine--tRNA ligase, cytoplasmic
2	9606.ENSP00000262027	0.999	Methionine--tRNA ligase, cytoplasmic
3	9606.ENSP00000264161	0.999	Aspartate--tRNA ligase, cytoplasmic
4	9606.ENSP00000307567	0.999	Glutamine--tRNA ligase
5	9606.ENSP00000325448	0.999	Lysine--tRNA ligase
6	9606.ENSP00000355890	0.999	Bifunctional glutamate/proline--tRNA ligase
7	9606.ENSP00000377954	0.999	Leucine--tRNA ligase, cytoplasmic
8	9606.ENSP00000378191	0.998	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
9	9606.ENSP00000373918	0.997	Glycine--tRNA ligase
10	9606.ENSP00000223029	0.996	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
11	9606.ENSP00000369038	0.996	Eukaryotic translation elongation factor 1 epsilon-1
12	9606.ENSP00000261772	0.991	Alanine--tRNA ligase, cytoplasmic
13	9606.ENSP00000256854	0.990	Asparagine--tRNA ligase, cytoplasmic
14	9606.ENSP00000362576	0.981	Tyrosine--tRNA ligase, cytoplasmic
15	9606.ENSP00000387710	0.977	Threonine--tRNA ligase, cytoplasmic
16	9606.ENSP00000369897	0.970	Cysteine--tRNA ligase, cytoplasmic
17	9606.ENSP00000364815	0.964	Valine--tRNA ligase
18	9606.ENSP00000441000	0.949	Valine--tRNA ligase, mitochondrial
19	9606.ENSP00000338093	0.947	Probable threonine--tRNA ligase 2, cytoplasmic
20	9606.ENSP00000358060	0.939	Threonine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004822	1.000	isoleucine-tRNA ligase activity
GO:0005515	0.980	protein binding
GO:0019899	0.381	enzyme binding
GO:0051020	0.343	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006412	0.990	translation
GO:0034660	0.980	ncRNA metabolic process
GO:0006418	0.967	tRNA aminoacylation for protein translation
GO:0065007	0.516	biological regulation
GO:0050789	0.460	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.996	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0005576	0.919	extracellular region
GO:0043230	0.876	extracellular organelle
GO:0140535	0.859	intracellular protein-containing complex
GO:0065010	0.837	extracellular membrane-bounded organelle
GO:1903561	0.830	extracellular vesicle
GO:0016020	0.810	membrane
GO:0070062	0.804	extracellular exosome
GO:1902494	0.599	catalytic complex
GO:0017101	0.411	aminoacyl-tRNA synthetase multienzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11060	1.000	ATP + L-isoleucine + tRNA(Ile) = AMP + diphosphate + L-isoleucyl-tRNA(Ile)
EC:6.1.1.5	1.000	isoleucine--tRNA ligase.

[back to server]