StarFunc result for job id P41271

User Input

>input (181 residues)
MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACL
GQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSC
QACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAE
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41271	1.000	1.000	2.252E-29	181	1.000	1.000	P41271.pdb.gz	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
2	AFDB:Q90YC9	0.669	0.684	1.358E-20	177	0.707	0.723	Q90YC9.pdb.gz	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
3	AFDB:O73753	0.609	0.628	1.736E-18	175	0.669	0.691	O73753.pdb.gz	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
4	AFDB:Q6NZ13	0.609	0.602	1.454E-17	183	0.591	0.585	Q6NZ13.pdb.gz	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
5	PDB:5hk5F	0.473	0.644	4.198E-8	129	0.193	0.271	5hk5F.pdb.gz
6	AFDB:O88273	0.506	0.544	5.016E-8	168	0.204	0.220	O88273.pdb.gz	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
7	AFDB:A0A0B5JK45	0.492	0.534	1.663E-7	166	0.171	0.187	A0A0B5JK45.pdb.gz
8	AFDB:Q76LW6	0.454	0.445	3.378E-7	185	0.160	0.157	Q76LW6.pdb.gz	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
9	AFDB:O73754	0.473	0.471	8.532E-7	182	0.177	0.176	O73754.pdb.gz	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
10	AFDB:O35793	0.469	0.462	9.514E-7	184	0.182	0.179	O35793.pdb.gz	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
11	AFDB:R0KDQ4	0.474	0.467	1.641E-6	184	0.182	0.179	R0KDQ4.pdb.gz	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
12	PDB:4my2A	0.398	0.160	9.634E-5	474	0.133	0.051	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
13	PDB:2k8pA	0.337	0.325	3.762E-4	189	0.193	0.185	2k8pA.pdb.gz
14	PDB:4mqwB	0.393	0.612	4.138E-3	109	0.127	0.211	4mqwB.pdb.gz
15	PDB:1hcnB	0.352	0.536	4.370E-3	110	0.116	0.191	1hcnB.pdb.gz
16	PDB:7t9iB	0.323	0.497	9.897E-3	109	0.133	0.220	7t9iB.pdb.gz
17	PDB:5nxsA	0.283	0.190	4.252E-1	290	0.066	0.041	5nxsA.pdb.gz
18	PDB:6q2sA	0.279	0.455	4.490E-1	98	0.094	0.173	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
19	PDB:1m4uA	0.273	0.251	5.287E-1	199	0.077	0.070	1m4uA.pdb.gz
20	PDB:5ntuA	0.274	0.172	9.118E-1	308	0.077	0.045	5ntuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41271	6.73e-132	368	181	1.000	1.000	NBL1_HUMAN Neuroblastoma suppressor of tumorigenicity 1 OS=Homo sapiens OX=9606 GN=NBL1 PE=1 SV=2
2	Q61477	3.44e-114	323	178	0.928	0.944	NBL1_MOUSE Neuroblastoma suppressor of tumorigenicity 1 OS=Mus musculus OX=10090 GN=Nbl1 PE=1 SV=2
3	O73753	6.03e-83	244	175	0.680	0.703	NBL1_XENLA Neuroblastoma suppressor of tumorigenicity 1 OS=Xenopus laevis OX=8355 GN=nbl1 PE=1 SV=1
4	Q90YC9	3.95e-80	237	177	0.713	0.729	NBL1_CHICK Neuroblastoma suppressor of tumorigenicity 1 OS=Gallus gallus OX=9031 GN=NBL1 PE=2 SV=2
5	Q6NZ13	7.74e-71	214	183	0.602	0.596	NBL1_DANRE Neuroblastoma suppressor of tumorigenicity 1 OS=Danio rerio OX=7955 GN=nbl1 PE=2 SV=1
6	O88273	5.02e-15	70.9	168	0.188	0.202	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
7	Q9H772	8.41e-14	67.8	168	0.182	0.196	GREM2_HUMAN Gremlin-2 OS=Homo sapiens OX=9606 GN=GREM2 PE=1 SV=1
8	R0KDQ4	1.65e-11	62.0	184	0.160	0.158	R0KDQ4_ANAPL Gremlin 1, DAN family BMP antagonist (Fragment) OS=Anas platyrhynchos OX=8839 GN=GREM1 PE=3 SV=1
9	O35793	2.39e-11	61.6	184	0.160	0.158	GREM1_RAT Gremlin-1 OS=Rattus norvegicus OX=10116 GN=Grem1 PE=1 SV=1
10	O73754	2.84e-11	61.2	182	0.155	0.154	GREM1_XENLA Gremlin-1 OS=Xenopus laevis OX=8355 GN=grem1 PE=2 SV=1
11	O60565	3.12e-11	61.2	184	0.160	0.158	GREM1_HUMAN Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1
12	O70326	3.36e-11	61.2	184	0.160	0.158	GREM1_MOUSE Gremlin-1 OS=Mus musculus OX=10090 GN=Grem1 PE=2 SV=1
13	Q566Z5	2.14e-10	58.5	166	0.160	0.175	Q566Z5_DANRE Gremlin OS=Danio rerio OX=7955 GN=grem2 PE=2 SV=1
14	Q76LW6	6.62e-10	57.8	185	0.155	0.151	DAND5_MOUSE DAN domain family member 5 OS=Mus musculus OX=10090 GN=Dand5 PE=2 SV=1
15	O95813	3.93e-05	45.1	267	0.182	0.124	CER1_HUMAN Cerberus OS=Homo sapiens OX=9606 GN=CER1 PE=1 SV=1
16	P70041	9.55e-05	43.9	270	0.116	0.078	CER1_XENLA Cerberus OS=Xenopus laevis OX=8355 GN=cer1 PE=1 SV=1
17	Q9PWB0	6.50e-04	41.6	272	0.138	0.092	CER1_CHICK Cerberus OS=Gallus gallus OX=9031 GN=CER1 PE=2 SV=1
18	Q9PUK2	8.07e-04	41.2	272	0.138	0.092	Q9PUK2_CHICK Caronte OS=Gallus gallus OX=9031 GN=CAR PE=2 SV=1
19	Q76C29	8.94e-04	40.8	243	0.149	0.111	Q76C29_DANRE DAN domain family, member 5 precursor OS=Danio rerio OX=7955 GN=charon PE=2 SV=1
20	Q21013	0.045	35.0	122	0.105	0.156	Q21013_CAEEL Bursicon OS=Caenorhabditis elegans OX=6239 GN=flr-2 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	0.0021	29.7	Cystine-knot domain
2	PF03045 DAN	2.6e-20	83.9	DAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009595

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017108	0.866	Bone morphogenetic protein 2
2	61853.ENSNLEP00000015368	0.853	Bone morphogenetic protein 4
3	61853.ENSNLEP00000004305	0.847	Growth differentiation factor 6
4	61853.ENSNLEP00000012475	0.847	Growth differentiation factor 5
5	61853.ENSNLEP00000008592	0.843	Bone morphogenetic protein 7
6	61853.ENSNLEP00000003942	0.839	Bone morphogenetic protein 5
7	61853.ENSNLEP00000003185	0.838	Growth differentiation factor 7
8	61853.ENSNLEP00000014621	0.838	Uncharacterized protein
9	61853.ENSNLEP00000024165	0.589	MICOS complex subunit MIC10
10	61853.ENSNLEP00000011648	0.534	LIM homeobox 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.988	identical protein binding
GO:0098772	0.959	molecular function regulator activity
GO:0005102	0.958	signaling receptor binding
GO:0030545	0.946	signaling receptor regulator activity
GO:0048018	0.928	receptor ligand activity
GO:0019955	0.760	cytokine binding
GO:0036122	0.352	BMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0009968	0.963	negative regulation of signal transduction
GO:0090288	0.959	negative regulation of cellular response to growth factor stimulus
GO:0090101	0.952	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030510	0.882	regulation of BMP signaling pathway
GO:0030514	0.796	negative regulation of BMP signaling pathway
GO:0032501	0.705	multicellular organismal process
GO:0007275	0.681	multicellular organism development
GO:0009987	0.608	cellular process
GO:0048518	0.352	positive regulation of biological process
GO:0050896	0.344	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.575	intracellular anatomical structure
GO:0043227	0.513	membrane-bounded organelle
GO:0032991	0.468	protein-containing complex
GO:0043229	0.394	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]