StarFunc result for job id P41273

User Input

>input (254 residues)
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV
TPEIPAGLPSPRSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41273	1.000	1.000	2.549E-44	254	1.000	1.000	P41273.pdb.gz	TNFL9_HUMAN Tumor necrosis factor ligand superfamily member 9 OS=Homo sapiens OX=9606 GN=TNFSF9 PE=1 SV=1
2	AFDB:Q80WE6	0.539	0.448	7.797E-17	308	0.350	0.289	Q80WE6.pdb.gz	Q80WE6_RAT TNF superfamily member 9 OS=Rattus norvegicus OX=10116 GN=Tnfsf9 PE=2 SV=1
3	AFDB:P41274	0.547	0.454	2.101E-16	309	0.335	0.275	P41274.pdb.gz	TNFL9_MOUSE Tumor necrosis factor ligand superfamily member 9 OS=Mus musculus OX=10090 GN=Tnfsf9 PE=1 SV=1
4	AFDB:O43508	0.405	0.413	7.827E-10	249	0.209	0.213	O43508.pdb.gz	TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 OS=Homo sapiens OX=9606 GN=TNFSF12 PE=1 SV=1
5	AFDB:Q6PGN1	0.410	0.318	8.688E-10	340	0.169	0.126	Q6PGN1.pdb.gz	ERFE_MOUSE Erythroferrone OS=Mus musculus OX=10090 GN=Erfe PE=1 SV=1
6	AFDB:O43557	0.474	0.499	1.542E-9	240	0.260	0.275	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
7	AFDB:P32972	0.446	0.470	1.712E-9	239	0.165	0.176	P32972.pdb.gz	TNFL8_MOUSE Tumor necrosis factor ligand superfamily member 8 OS=Mus musculus OX=10090 GN=Tnfsf8 PE=2 SV=1
8	AFDB:Q8K3Y7	0.438	0.441	3.039E-9	252	0.181	0.183	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
9	AFDB:E7F3U1	0.454	0.459	3.945E-9	251	0.177	0.179	E7F3U1.pdb.gz	E7F3U1_DANRE TNF superfamily member 11 OS=Danio rerio OX=7955 GN=tnfsf11 PE=3 SV=1
10	AFDB:Q1JQ40	0.430	0.449	4.860E-9	242	0.169	0.178	Q1JQ40.pdb.gz
11	PDB:5kc6B	0.388	0.624	4.102E-6	144	0.071	0.125	5kc6B.pdb.gz
12	PDB:5h4bA	0.356	0.613	1.862E-5	136	0.083	0.154	5h4bA.pdb.gz
13	PDB:7e57B	0.292	0.537	2.163E-4	123	0.067	0.138	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:3o12A	0.128	0.152	1.732E-2	185	0.071	0.097	3o12A.pdb.gz
15	PDB:1js9C	0.240	0.295	2.368E-2	189	0.126	0.169	1js9C.pdb.gz
16	PDB:6ve73	0.150	0.185	5.457E-2	187	0.051	0.070	6ve73.pdb.gz	The inner junction complex of the cilia is an interaction hub that involves tubulin post-translational modifications.
17	PDB:7rslA	0.297	0.316	5.457E-2	235	0.079	0.085	7rslA.pdb.gz
18	PDB:4tlgA	0.157	0.107	6.057E-2	396	0.043	0.028	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:5eiyB	0.182	0.090	6.381E-2	658	0.055	0.021	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
20	PDB:7l2zF	0.171	0.085	7.463E-2	664	0.094	0.036	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P41273	1.11e-179	495	254	1.000	1.000	TNFL9_HUMAN Tumor necrosis factor ligand superfamily member 9 OS=Homo sapiens OX=9606 GN=TNFSF9 PE=1 SV=1
2	Q80WE6	8.58e-22	94.0	308	0.370	0.305	Q80WE6_RAT TNF superfamily member 9 OS=Rattus norvegicus OX=10116 GN=Tnfsf9 PE=2 SV=1
3	P41274	2.41e-19	87.4	309	0.252	0.207	TNFL9_MOUSE Tumor necrosis factor ligand superfamily member 9 OS=Mus musculus OX=10090 GN=Tnfsf9 PE=1 SV=1
4	O43557	0.022	37.7	240	0.213	0.225	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
5	A0A8I5ZY27	0.041	37.0	289	0.122	0.107	A0A8I5ZY27_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=3 SV=1
6	A0A0U5J7B5	0.050	37.0	292	0.122	0.106	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
7	O39498	0.29	33.9	158	0.118	0.190	O39498_9ALPH Glycoprotein L OS=Bovine herpesvirus type 1.1 OX=79889 GN=UL1 PE=4 SV=1
8	P50592	0.37	34.3	291	0.122	0.107	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
9	Q9QYH9	0.99	32.7	239	0.150	0.159	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
10	O43508	2.9	31.2	249	0.051	0.052	TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 OS=Homo sapiens OX=9606 GN=TNFSF12 PE=1 SV=1
11	Q4ACW9	2.9	31.2	249	0.051	0.052	Q4ACW9_HUMAN HCG1991317, isoform CRA_b OS=Homo sapiens OX=9606 GN=TWEAK PE=1 SV=1
12	A0A8I5ZLI7	6.7	30.4	447	0.098	0.056	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	5.1e-18	76.7	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245817

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478699	0.999	Tumor necrosis factor receptor superfamily member 9
2	9606.ENSP00000363089	0.964	Toll-like receptor 4
3	9606.ENSP00000247668	0.948	TNF receptor-associated factor 2
4	9606.ENSP00000264246	0.923	T-lymphocyte activation antigen CD80
5	9606.ENSP00000351908	0.904	Mitogen-activated protein kinase kinase kinase 5
6	9606.ENSP00000320084	0.864	CD276 antigen
7	9606.ENSP00000306887	0.835	Transmembrane protein 126A
8	9606.ENSP00000281834	0.806	Tumor necrosis factor ligand superfamily member 4
9	9606.ENSP00000162749	0.804	Tumor necrosis factor receptor superfamily member 1A
10	9606.ENSP00000245903	0.797	CD70 antigen
11	9606.ENSP00000386559	0.789	T-cell surface glycoprotein CD8 alpha chain
12	9606.ENSP00000011653	0.746	T-cell surface glycoprotein CD4
13	9606.ENSP00000368538	0.730	Tumor necrosis factor receptor superfamily member 4
14	9606.ENSP00000296545	0.709	Interleukin-15
15	9606.ENSP00000303939	0.686	Cytotoxic T-lymphocyte protein 4
16	9606.ENSP00000324890	0.682	T-cell-specific surface glycoprotein CD28
17	9606.ENSP00000385470	0.682	Tumor necrosis factor ligand superfamily member 18
18	9606.ENSP00000223795	0.681	Tumor necrosis factor ligand superfamily member 8
19	9606.ENSP00000332049	0.681	T-lymphocyte activation antigen CD86
20	9606.ENSP00000398698	0.679	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0098772	0.318	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051239	0.990	regulation of multicellular organismal process
GO:0023052	0.989	signaling
GO:0007154	0.989	cell communication
GO:0042129	0.978	regulation of T cell proliferation
GO:0010941	0.972	regulation of cell death
GO:0042981	0.924	regulation of apoptotic process
GO:0050896	0.868	response to stimulus
GO:0048518	0.857	positive regulation of biological process
GO:0051716	0.820	cellular response to stimulus
GO:0007165	0.807	signal transduction
GO:0048522	0.780	positive regulation of cellular process
GO:0007267	0.623	cell-cell signaling
GO:0002376	0.461	immune system process
GO:0019222	0.441	regulation of metabolic process
GO:0009893	0.419	positive regulation of metabolic process
GO:0006955	0.418	immune response
GO:0060255	0.411	regulation of macromolecule metabolic process
GO:0002684	0.389	positive regulation of immune system process
GO:0010604	0.377	positive regulation of macromolecule metabolic process
GO:0051240	0.365	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.712	extracellular region
GO:0043227	0.505	membrane-bounded organelle
GO:0005622	0.421	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]