StarFunc result for job id P41440

User Input

>input (591 residues)
MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFT
REQVTNEITPVLSYSYLAVLVPVFLLTDYLRYTPVLLLQGLSFVSVWLLLLLGHSVAHMQ
LMELFYSVTMAARIAYSSYIFSLVRPARYQRVAGYSRAAVLLGVFTSSVLGQLLVTVGRV
SFSTLNYISLAFLTFSVVLALFLKRPKRSLFFNRDDRGRCETSASELERMNPGPGGKLGH
ALRVACGDSVLARMLRELGDSLRRPQLRLWSLWWVFNSAGYYLVVYYVHILWNEVDPTTN
SARVYNGAADAASTLLGAITSFAAGFVKIRWARWSKLLIAGVTATQAGLVFLLAHTRHPS
SIWLCYAAFVLFRGSYQFLVPIATFQIASSLSKELCALVFGVNTFFATIVKTIITFIVSD
VRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKA
AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPV
TTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41440	1.000	1.000	6.340E-72	591	1.000	1.000	P41440.pdb.gz	S19A1_HUMAN Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3
2	AFDB:F1N2M7	0.696	0.808	9.688E-43	508	0.621	0.722	F1N2M7.pdb.gz	F1N2M7_BOVIN Reduced folate transporter OS=Bos taurus OX=9913 GN=SLC19A1 PE=3 SV=3
3	AFDB:P41438	0.701	0.806	1.387E-40	512	0.558	0.645	P41438.pdb.gz	S19A1_MOUSE Reduced folate transporter OS=Mus musculus OX=10090 GN=Slc19a1 PE=1 SV=1
4	AFDB:Q62866	0.703	0.808	9.247E-40	512	0.552	0.637	Q62866.pdb.gz	S19A1_RAT Reduced folate transporter OS=Rattus norvegicus OX=10116 GN=Slc19a1 PE=1 SV=2
5	AFDB:Q9BZV2	0.668	0.793	1.151E-28	496	0.330	0.393	Q9BZV2.pdb.gz	S19A3_HUMAN Thiamine transporter 2 OS=Homo sapiens OX=9606 GN=SLC19A3 PE=1 SV=1
6	AFDB:Q99PL8	0.674	0.810	4.361E-28	488	0.310	0.375	Q99PL8.pdb.gz	S19A3_MOUSE Thiamine transporter 2 OS=Mus musculus OX=10090 GN=Slc19a3 PE=1 SV=2
7	AFDB:Q9EQN9	0.691	0.817	4.361E-28	498	0.318	0.378	Q9EQN9.pdb.gz	S19A2_MOUSE Thiamine transporter 1 OS=Mus musculus OX=10090 GN=Slc19a2 PE=1 SV=1
8	AFDB:P9WG87	0.515	0.524	2.800E-9	579	0.129	0.131	P9WG87.pdb.gz	Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1250 PE=3 SV=1
9	AFDB:Q38BR2	0.503	0.538	6.028E-9	545	0.140	0.152	Q38BR2.pdb.gz	Q38BR2_TRYB2 MFS transporter OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4090 PE=4 SV=1
10	AFDB:P87110	0.486	0.512	6.277E-9	557	0.129	0.136	P87110.pdb.gz	ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=itr2 PE=2 SV=1
11	PDB:7wsmA	0.480	0.589	8.681E-8	464	0.118	0.151	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
12	PDB:6thaA	0.471	0.595	2.581E-7	448	0.124	0.163	6thaA.pdb.gz
13	PDB:7aaqA	0.439	0.514	2.688E-7	487	0.083	0.101	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
14	PDB:7sptA	0.395	0.470	5.338E-7	470	0.108	0.136	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
15	PDB:6s4mA	0.379	0.485	2.908E-6	426	0.105	0.146	6s4mA.pdb.gz
16	PDB:7bc7A	0.359	0.461	3.417E-6	432	0.086	0.118	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
17	PDB:7dl9A	0.479	0.657	5.327E-6	405	0.088	0.128	7dl9A.pdb.gz
18	PDB:4iu9A	0.459	0.641	7.357E-6	396	0.110	0.164	4iu9A.pdb.gz
19	PDB:1pv7A	0.466	0.624	7.975E-6	417	0.108	0.153	1pv7A.pdb.gz
20	PDB:4q65A	0.469	0.603	1.016E-5	437	0.117	0.158	4q65A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1N2M7	0.0	694	508	0.621	0.722	F1N2M7_BOVIN Reduced folate transporter OS=Bos taurus OX=9913 GN=SLC19A1 PE=3 SV=3
2	P41438	0.0	624	512	0.575	0.664	S19A1_MOUSE Reduced folate transporter OS=Mus musculus OX=10090 GN=Slc19a1 PE=1 SV=1
3	P41440	0.0	1199	591	1.000	1.000	S19A1_HUMAN Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3
4	Q62866	0.0	608	512	0.572	0.660	S19A1_RAT Reduced folate transporter OS=Rattus norvegicus OX=10116 GN=Slc19a1 PE=1 SV=2
5	Q9BZV2	8.55e-113	347	496	0.330	0.393	S19A3_HUMAN Thiamine transporter 2 OS=Homo sapiens OX=9606 GN=SLC19A3 PE=1 SV=1
6	Q99PL8	8.69e-110	339	488	0.316	0.383	S19A3_MOUSE Thiamine transporter 2 OS=Mus musculus OX=10090 GN=Slc19a3 PE=1 SV=2
7	Q9EQN9	7.14e-106	330	498	0.323	0.384	S19A2_MOUSE Thiamine transporter 1 OS=Mus musculus OX=10090 GN=Slc19a2 PE=1 SV=1
8	O60779	2.16e-104	326	497	0.316	0.376	S19A2_HUMAN Thiamine transporter 1 OS=Homo sapiens OX=9606 GN=SLC19A2 PE=1 SV=2
9	Q53S99	0.013	38.9	150	0.030	0.120	CB083_HUMAN Folate transporter-like protein C2orf83 OS=Homo sapiens OX=9606 GN=C2orf83 PE=1 SV=1
10	Q9P219	0.71	35.4	2028	0.047	0.014	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
11	Q9QYX7	1.0	35.0	5068	0.058	0.007	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
12	O42579	2.1	33.9	664	0.037	0.033	FZD3_XENLA Frizzled-3 OS=Xenopus laevis OX=8355 GN=fzd3 PE=1 SV=1
13	P01921	3.5	32.7	265	0.029	0.064	HB2D_MOUSE H-2 class II histocompatibility antigen, A-D beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
14	P06342	5.0	32.0	265	0.029	0.064	HB2Q_MOUSE H-2 class II histocompatibility antigen, A-Q beta chain OS=Mus musculus OX=10090 GN=H2-Ab1 PE=1 SV=1
15	Q21434	5.7	32.3	562	0.030	0.032	NRAMA_CAEEL NRAMP-like transporter smf-1 OS=Caenorhabditis elegans OX=6239 GN=smf-1 PE=1 SV=2
16	Q9JKS6	8.9	32.0	5085	0.058	0.007	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20555 DUF6767	1.8e+02	13.3	Domain of unknown function (DUF6767)
2	PF01770 Folate_carrier	1.1e-171	582.8	Reduced folate carrier

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312304	0.908	Thiopurine S-methyltransferase
2	9606.ENSP00000260118	0.905	Gamma-glutamyl hydrolase
3	9606.ENSP00000480703	0.877	Proton-coupled folate transporter
4	9606.ENSP00000365777	0.805	Methylenetetrahydrofolate reductase
5	9606.ENSP00000377284	0.776	Folate receptor alpha
6	9606.ENSP00000264668	0.762	Methionine synthase reductase
7	9606.ENSP00000396308	0.755	Dihydrofolate reductase
8	9606.ENSP00000355536	0.745	Methionine synthase
9	9606.ENSP00000315644	0.740	Thymidylate synthase
10	9606.ENSP00000215838	0.736	Transcobalamin-2
11	9606.ENSP00000362344	0.733	Folylpolyglutamate synthase, mitochondrial
12	9606.ENSP00000216605	0.732	C-1-tetrahydrofolate synthase, cytoplasmic
13	9606.ENSP00000298223	0.724	Folate receptor beta
14	9606.ENSP00000318868	0.688	Serine hydroxymethyltransferase, cytosolic
15	9606.ENSP00000481114	0.685	Folate receptor gamma
16	9606.ENSP00000236959	0.683	Bifunctional purine biosynthesis protein PURH
17	9606.ENSP00000365686	0.678	Solute carrier family 15 member 1
18	9606.ENSP00000310241	0.677	Solute carrier family 22 member 13
19	9606.ENSP00000358896	0.671	Arsenite methyltransferase
20	9606.ENSP00000383168	0.667	Poly(rC)-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901702	0.999	salt transmembrane transporter activity
GO:0008509	0.999	monoatomic anion transmembrane transporter activity
GO:0022853	0.999	active monoatomic ion transmembrane transporter activity
GO:0015297	0.999	antiporter activity
GO:0008517	0.997	folic acid transmembrane transporter activity
GO:0005515	0.995	protein binding
GO:0042910	0.992	xenobiotic transmembrane transporter activity
GO:0005310	0.992	dicarboxylic acid transmembrane transporter activity
GO:0043168	0.976	anion binding
GO:1901363	0.962	heterocyclic compound binding
GO:0097159	0.962	organic cyclic compound binding
GO:0036094	0.960	small molecule binding
GO:0008518	0.876	folate:monoatomic anion antiporter activity
GO:0015350	0.835	methotrexate transmembrane transporter activity
GO:0015215	0.609	nucleotide transmembrane transporter activity
GO:1901265	0.599	nucleoside phosphate binding
GO:0015216	0.585	purine nucleotide transmembrane transporter activity
GO:0000166	0.581	nucleotide binding
GO:1901505	0.564	carbohydrate derivative transmembrane transporter activity
GO:0017076	0.544	purine nucleotide binding
GO:0000295	0.481	adenine nucleotide transmembrane transporter activity
GO:0005346	0.467	purine ribonucleotide transmembrane transporter activity
GO:0019001	0.402	guanyl nucleotide binding
GO:0097367	0.397	carbohydrate derivative binding
GO:0032553	0.389	ribonucleotide binding
GO:0032555	0.375	purine ribonucleotide binding
GO:0030551	0.358	cyclic nucleotide binding
GO:0032561	0.342	guanyl ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0015711	0.992	organic anion transport
GO:0072337	0.992	modified amino acid transport
GO:0055085	0.981	transmembrane transport
GO:0046942	0.971	carboxylic acid transport
GO:0042886	0.963	amide transport
GO:0006835	0.960	dicarboxylic acid transport
GO:1905039	0.937	carboxylic acid transmembrane transport
GO:0008152	0.933	metabolic process
GO:0044237	0.906	cellular metabolic process
GO:0051180	0.847	vitamin transport
GO:0071704	0.838	organic substance metabolic process
GO:0035461	0.815	vitamin transmembrane transport
GO:0006807	0.708	nitrogen compound metabolic process
GO:1901564	0.682	organonitrogen compound metabolic process
GO:1901360	0.643	organic cyclic compound metabolic process
GO:0044281	0.629	small molecule metabolic process
GO:0046483	0.613	heterocycle metabolic process
GO:0006725	0.594	cellular aromatic compound metabolic process
GO:0098657	0.480	import into cell
GO:0098739	0.405	import across plasma membrane
GO:0006575	0.369	cellular modified amino acid metabolic process
GO:0006766	0.357	vitamin metabolic process
GO:0006767	0.345	water-soluble vitamin metabolic process
GO:0019752	0.326	carboxylic acid metabolic process
GO:0032501	0.323	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.996	plasma membrane region
GO:0016324	0.992	apical plasma membrane
GO:0009925	0.927	basal plasma membrane
GO:0016323	0.845	basolateral plasma membrane
GO:0043226	0.785	organelle
GO:0043227	0.784	membrane-bounded organelle
GO:0005622	0.761	intracellular anatomical structure
GO:0005737	0.524	cytoplasm
GO:0043231	0.501	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]