StarFunc result for job id P41594

User Input

>input (1212 residues)
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H0ZKH5	0.671	0.687	0.000	1184	0.597	0.611	H0ZKH5.pdb.gz	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
2	AFDB:H0ZRP5	0.709	0.692	0.000	1243	0.886	0.864	H0ZRP5.pdb.gz	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
3	AFDB:P23385	0.677	0.684	0.000	1199	0.602	0.609	P23385.pdb.gz	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
4	AFDB:P41594	1.000	1.000	0.000	1212	1.000	1.000	P41594.pdb.gz	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
5	AFDB:P31421	0.587	0.791	7.244E-85	872	0.316	0.439	P31421.pdb.gz	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
6	AFDB:O00222	0.620	0.815	2.834E-83	908	0.301	0.402	O00222.pdb.gz	GRM8_HUMAN Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2
7	AFDB:P31423	0.582	0.755	1.387E-80	912	0.294	0.390	P31423.pdb.gz	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
8	PDB:7e9gR	0.529	0.794	3.967E-69	769	0.293	0.462	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
9	PDB:7epaA	0.562	0.841	3.796E-65	782	0.285	0.442	7epaA.pdb.gz
10	PDB:7epcA	0.565	0.848	2.046E-64	782	0.271	0.419	7epcA.pdb.gz
11	PDB:7e9hR	0.509	0.761	7.420E-64	766	0.282	0.446	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
12	PDB:7wihA	0.508	0.786	1.253E-60	741	0.271	0.443	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
13	PDB:7dtvA	0.556	0.840	5.750E-51	779	0.189	0.294	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
14	PDB:7c7sA	0.265	0.436	2.137E-32	685	0.113	0.200	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
15	PDB:6ffhA	0.200	0.577	2.372E-28	414	0.202	0.592	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
16	PDB:6w2xB	0.268	0.415	2.263E-26	669	0.117	0.212	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
17	PDB:4tllA	0.238	0.362	2.474E-15	767	0.068	0.108	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
18	AFDB:A0A0R4IF44	0.218	0.151	1.764E-12	1792	0.106	0.072	A0A0R4IF44.pdb.gz
19	AFDB:E9PY61	0.209	0.117	8.613E-12	2293	0.120	0.064	E9PY61.pdb.gz	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1
20	AFDB:Q6PRD1	0.210	0.115	2.438E-11	2367	0.116	0.059	Q6PRD1.pdb.gz	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KF15	641	1472	0.290	0.238	A0A0B4KF15_DROME Mangetout, isoform G OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
2	A1L1T5	650	905	0.290	0.388	A1L1T5_DANRE Glutamate receptor, metabotropic 6b OS=Danio rerio OX=7955 GN=cb496 PE=2 SV=1
3	A1Z7F4	637	1095	0.288	0.319	A1Z7F4_DROME Mangetout, isoform E OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
4	A1Z7F5	638	1248	0.290	0.281	A1Z7F5_DROME Mangetout, isoform F OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=2
5	B7YZT0	639	1415	0.290	0.248	B7YZT0_DROME Mangetout, isoform D OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
6	H0ZKH5	1391	1184	0.607	0.622	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
7	H0ZRP5	2078	1243	0.864	0.842	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
8	O00222	670	908	0.301	0.402	GRM8_HUMAN Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2
9	O15303	611	877	0.281	0.388	GRM6_HUMAN Metabotropic glutamate receptor 6 OS=Homo sapiens OX=9606 GN=GRM6 PE=1 SV=2
10	P23385	1389	1199	0.613	0.620	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
11	P31421	672	872	0.306	0.425	GRM2_RAT Metabotropic glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Grm2 PE=1 SV=1
12	P31422	693	879	0.312	0.430	GRM3_RAT Metabotropic glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Grm3 PE=1 SV=1
13	P31423	649	912	0.291	0.387	GRM4_RAT Metabotropic glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Grm4 PE=1 SV=1
14	P31424	2308	1203	0.939	0.946	GRM5_RAT Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2
15	P35349	596	871	0.281	0.392	GRM6_RAT Metabotropic glutamate receptor 6 OS=Rattus norvegicus OX=10116 GN=Grm6 PE=2 SV=1
16	P35400	659	915	0.292	0.387	GRM7_RAT Metabotropic glutamate receptor 7 OS=Rattus norvegicus OX=10116 GN=Grm7 PE=1 SV=1
17	P41594	2519	1212	1.000	1.000	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
18	P47743	666	908	0.300	0.401	GRM8_MOUSE Metabotropic glutamate receptor 8 OS=Mus musculus OX=10090 GN=Grm8 PE=1 SV=2
19	P70579	663	908	0.300	0.400	GRM8_RAT Metabotropic glutamate receptor 8 OS=Rattus norvegicus OX=10116 GN=Grm8 PE=1 SV=1
20	P91685	649	976	0.293	0.364	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	2.1e-53	193.2	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF01094 ANF_receptor	9.4e-96	332.6	Receptor family ligand binding region
3	PF17506 DUF5438	3.8e+02	12.8	Family of unknown function (DUF5438)
4	PF10606 GluR_Homer-bdg	2.1e-18	77.5	Homer-binding domain of metabotropic glutamate receptor
5	PF07562 NCD3G	9.6e-12	55.9	Nine Cysteines Domain of family 3 GPCR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306138

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334382	0.998	Homer protein homolog 1
2	9606.ENSP00000286548	0.997	Guanine nucleotide-binding protein G(q) subunit alpha
3	9606.ENSP00000480012	0.985	annotation not available
4	9606.ENSP00000368752	0.983	Major prion protein
5	9606.ENSP00000354896	0.970	Metabotropic glutamate receptor 1
6	9606.ENSP00000372654	0.958	Aquaporin-4
7	9606.ENSP00000382428	0.953	Disks large homolog 4
8	9606.ENSP00000405330	0.952	Estrogen receptor
9	9606.ENSP00000305632	0.938	Homer protein homolog 2
10	9606.ENSP00000293441	0.931	SH3 and multiple ankyrin repeat domains protein 1
11	9606.ENSP00000381412	0.928	Calcium/calmodulin-dependent protein kinase type II subunit alpha
12	9606.ENSP00000420194	0.928	Extracellular calcium-sensing receptor
13	9606.ENSP00000360608	0.916	Glutamate receptor ionotropic, NMDA 1
14	9606.ENSP00000477455	0.908	Glutamate receptor ionotropic, NMDA 2B
15	9606.ENSP00000306490	0.906	Muscarinic acetylcholine receptor M1
16	9606.ENSP00000316377	0.906	Disks large-associated protein 1
17	9606.ENSP00000293662	0.900	General receptor for phosphoinositides 1-associated scaffold protein
18	9606.ENSP00000379098	0.887	Calcium/calmodulin-dependent protein kinase type II subunit beta
19	9606.ENSP00000354859	0.885	D(2) dopamine receptor
20	9606.ENSP00000439937	0.884	Homer protein homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008066	1.000	glutamate receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0010646	0.995	regulation of cell communication
GO:0050896	0.993	response to stimulus
GO:0065008	0.974	regulation of biological quality
GO:0023051	0.971	regulation of signaling
GO:0007165	0.966	signal transduction
GO:0032501	0.961	multicellular organismal process
GO:0007186	0.944	G protein-coupled receptor signaling pathway
GO:0099177	0.936	regulation of trans-synaptic signaling
GO:0007267	0.882	cell-cell signaling
GO:0007215	0.874	glutamate receptor signaling pathway
GO:0007268	0.856	chemical synaptic transmission
GO:0048518	0.853	positive regulation of biological process
GO:0003008	0.846	system process
GO:0044093	0.831	positive regulation of molecular function
GO:0050804	0.804	modulation of chemical synaptic transmission
GO:0048522	0.788	positive regulation of cellular process
GO:0050790	0.755	regulation of catalytic activity
GO:0019222	0.745	regulation of metabolic process
GO:0048519	0.690	negative regulation of biological process
GO:0042221	0.687	response to chemical
GO:0007204	0.686	positive regulation of cytosolic calcium ion concentration
GO:0060255	0.681	regulation of macromolecule metabolic process
GO:0048583	0.662	regulation of response to stimulus
GO:0042327	0.648	positive regulation of phosphorylation
GO:0051247	0.643	positive regulation of protein metabolic process
GO:0007200	0.634	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0031399	0.619	regulation of protein modification process
GO:0051239	0.599	regulation of multicellular organismal process
GO:0009966	0.599	regulation of signal transduction
GO:0031401	0.574	positive regulation of protein modification process
GO:0001932	0.542	regulation of protein phosphorylation
GO:0050877	0.501	nervous system process
GO:0051338	0.450	regulation of transferase activity
GO:0001934	0.450	positive regulation of protein phosphorylation
GO:0048523	0.403	negative regulation of cellular process
GO:0010033	0.394	response to organic substance
GO:1901700	0.334	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.893	intracellular anatomical structure
GO:0043226	0.807	organelle
GO:0005737	0.725	cytoplasm
GO:0043227	0.619	membrane-bounded organelle
GO:0043005	0.593	neuron projection
GO:0045202	0.486	synapse
GO:0036477	0.450	somatodendritic compartment
GO:0043229	0.363	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]