StarFunc result for job id P41595

User Input

>input (481 residues)
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41595	1.000	1.000	8.326E-60	481	1.000	1.000	P41595.pdb.gz	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
2	AFDB:Q02152	0.827	0.830	2.496E-49	479	0.832	0.835	Q02152.pdb.gz	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
3	AFDB:P30994	0.758	0.761	1.663E-47	479	0.815	0.818	P30994.pdb.gz	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
4	AFDB:Q50DZ8	0.749	0.827	2.529E-44	434	0.763	0.846	Q50DZ8.pdb.gz	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
5	AFDB:Q8UUG8	0.660	0.673	4.030E-33	471	0.536	0.548	Q8UUG8.pdb.gz	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
6	AFDB:P14842	0.602	0.614	3.913E-28	471	0.407	0.416	P14842.pdb.gz	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
7	AFDB:O46635	0.627	0.641	1.244E-27	470	0.401	0.411	O46635.pdb.gz	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
8	AFDB:P08909	0.591	0.616	1.016E-26	460	0.401	0.420	P08909.pdb.gz	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
9	AFDB:G3M4F8	0.558	0.668	5.196E-18	395	0.229	0.278	G3M4F8.pdb.gz	OCTB2_CHISP Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1
10	AFDB:Q9VCZ3	0.560	0.533	5.196E-18	508	0.258	0.244	Q9VCZ3.pdb.gz	OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster OX=7227 GN=Octbeta1R PE=2 SV=1
11	PDB:7e32R	0.496	0.817	8.934E-16	285	0.191	0.323	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
12	PDB:7jvqR	0.489	0.803	1.646E-14	286	0.208	0.350	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
13	PDB:6iblA	0.507	0.609	1.954E-14	397	0.202	0.244	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
14	PDB:7cmuR	0.503	0.868	2.873E-14	272	0.191	0.338	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
15	PDB:3pblA	0.519	0.574	7.066E-14	432	0.210	0.234	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
16	PDB:7e33R	0.471	0.863	9.955E-14	257	0.187	0.350	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
17	PDB:7jvrR	0.489	0.857	2.555E-13	269	0.208	0.372	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
18	PDB:7e2xR	0.496	0.834	3.033E-13	278	0.202	0.349	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
19	PDB:7xt8R	0.479	0.763	3.304E-13	294	0.200	0.327	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
20	PDB:7f61A	0.513	0.802	6.020E-13	301	0.156	0.249	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30994	0.0	783	479	0.815	0.818	5HT2B_RAT 5-hydroxytryptamine receptor 2B OS=Rattus norvegicus OX=10116 GN=Htr2b PE=2 SV=1
2	P41595	0.0	991	481	1.000	1.000	5HT2B_HUMAN 5-hydroxytryptamine receptor 2B OS=Homo sapiens OX=9606 GN=HTR2B PE=1 SV=1
3	Q02152	0.0	802	479	0.832	0.835	5HT2B_MOUSE 5-hydroxytryptamine receptor 2B OS=Mus musculus OX=10090 GN=Htr2b PE=1 SV=3
4	Q50DZ8	0.0	748	434	0.759	0.841	Q50DZ8_CANLF 5-hydroxytryptamine receptor 2B OS=Canis lupus familiaris OX=9615 GN=5HT2B PE=2 SV=1
5	Q8UUG8	4.18e-176	504	471	0.563	0.575	5HT2B_TETFL 5-hydroxytryptamine receptor 2B OS=Tetraodon fluviatilis OX=47145 GN=htr2b PE=2 SV=1
6	O46635	2.24e-125	375	470	0.387	0.396	5HT2A_CANLF 5-hydroxytryptamine receptor 2A OS=Canis lupus familiaris OX=9615 GN=HTR2A PE=2 SV=2
7	P28223	1.27e-123	370	471	0.387	0.395	5HT2A_HUMAN 5-hydroxytryptamine receptor 2A OS=Homo sapiens OX=9606 GN=HTR2A PE=1 SV=2
8	P35363	1.48e-123	370	471	0.395	0.403	5HT2A_MOUSE 5-hydroxytryptamine receptor 2A OS=Mus musculus OX=10090 GN=Htr2a PE=1 SV=1
9	P14842	2.19e-123	370	471	0.387	0.395	5HT2A_RAT 5-hydroxytryptamine receptor 2A OS=Rattus norvegicus OX=10116 GN=Htr2a PE=1 SV=1
10	P08909	7.49e-121	363	460	0.374	0.391	5HT2C_RAT 5-hydroxytryptamine receptor 2C OS=Rattus norvegicus OX=10116 GN=Htr2c PE=1 SV=1
11	P34968	2.12e-120	362	459	0.376	0.394	5HT2C_MOUSE 5-hydroxytryptamine receptor 2C OS=Mus musculus OX=10090 GN=Htr2c PE=1 SV=2
12	P28335	2.77e-112	341	458	0.378	0.397	5HT2C_HUMAN 5-hydroxytryptamine receptor 2C OS=Homo sapiens OX=9606 GN=HTR2C PE=1 SV=2
13	G1NQ48	9.38e-59	197	308	0.220	0.344	G1NQ48_MELGA 5-hydroxytryptamine receptor 2A OS=Meleagris gallopavo OX=9103 PE=3 SV=2
14	G5ECV2	1.11e-49	181	635	0.256	0.194	G5ECV2_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
15	O17470	3.20e-49	181	683	0.256	0.180	O17470_CAEEL G-protein coupled receptors family 1 profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ser-1 PE=2 SV=1
16	C0ITL9	1.05e-47	171	403	0.239	0.285	C0ITL9_DANRE 5-hydroxytryptamine (serotonin) receptor 1A B OS=Danio rerio OX=7955 GN=htr1ab PE=2 SV=1
17	Q64264	1.38e-47	171	421	0.258	0.295	5HT1A_MOUSE 5-hydroxytryptamine receptor 1A OS=Mus musculus OX=10090 GN=Htr1a PE=2 SV=2
18	G3MWM5	1.39e-47	171	414	0.254	0.295	G3MWM5_BOVIN D(2) dopamine receptor OS=Bos taurus OX=9913 GN=DRD2 PE=3 SV=1
19	A0A060YRM0	5.00e-47	169	395	0.252	0.306	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
20	G3M4F8	1.57e-46	168	395	0.227	0.276	OCTB2_CHISP Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5e-60	214.6	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.41	22.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	2.1e-07	42.2	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.014	26.4	Serpentine type 7TM GPCR chemoreceptor Srv

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258400

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.933	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000078429	0.875	Guanine nucleotide-binding protein subunit alpha-11
3	9606.ENSP00000276198	0.868	5-hydroxytryptamine receptor 2C
4	9606.ENSP00000437737	0.868	5-hydroxytryptamine receptor 2A
5	9606.ENSP00000260191	0.838	5-hydroxytryptamine receptor 3B
6	9606.ENSP00000261707	0.764	Sodium-dependent serotonin transporter
7	9606.ENSP00000378492	0.706	Metabotropic glutamate receptor 2
8	9606.ENSP00000386444	0.697	S-arrestin
9	9606.ENSP00000250018	0.692	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
10	9606.ENSP00000347754	0.681	5-hydroxytryptamine receptor 3A
11	9606.ENSP00000387549	0.669	Chromaffin granule amine transporter
12	9606.ENSP00000262958	0.663	Guanine nucleotide-binding protein subunit alpha-15
13	9606.ENSP00000408292	0.661	E3 ubiquitin-protein ligase TRIM32
14	9606.ENSP00000266376	0.656	Voltage-dependent L-type calcium channel subunit alpha-1C
15	9606.ENSP00000365807	0.653	Guanine nucleotide-binding protein subunit alpha-14
16	9606.ENSP00000288139	0.640	Voltage-dependent L-type calcium channel subunit alpha-1D
17	9606.ENSP00000355192	0.630	Voltage-dependent L-type calcium channel subunit alpha-1S
18	9606.ENSP00000365441	0.630	Voltage-dependent L-type calcium channel subunit alpha-1F
19	9606.ENSP00000340913	0.593	Short transient receptor potential channel 6
20	9606.ENSP00000264428	0.592	Glycine receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043176	1.000	amine binding
GO:0043169	1.000	cation binding
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0004993	0.997	G protein-coupled serotonin receptor activity
GO:0005515	0.991	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0051716	0.985	cellular response to stimulus
GO:0010033	0.985	response to organic substance
GO:0050794	0.983	regulation of cellular process
GO:0071867	0.967	response to monoamine
GO:0071417	0.965	cellular response to organonitrogen compound
GO:0006811	0.943	monoatomic ion transport
GO:0007154	0.936	cell communication
GO:0023052	0.935	signaling
GO:0032501	0.929	multicellular organismal process
GO:0007165	0.927	signal transduction
GO:0071407	0.917	cellular response to organic cyclic compound
GO:0007186	0.917	G protein-coupled receptor signaling pathway
GO:0048519	0.896	negative regulation of biological process
GO:0007210	0.874	serotonin receptor signaling pathway
GO:0006816	0.857	calcium ion transport
GO:0098662	0.831	inorganic cation transmembrane transport
GO:0070588	0.751	calcium ion transmembrane transport
GO:0007200	0.738	phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0097553	0.692	calcium ion transmembrane import into cytosol
GO:0051282	0.683	regulation of sequestering of calcium ion
GO:0048523	0.679	negative regulation of cellular process
GO:0051209	0.644	release of sequestered calcium ion into cytosol
GO:0019222	0.528	regulation of metabolic process
GO:0048518	0.494	positive regulation of biological process
GO:0048522	0.441	positive regulation of cellular process
GO:0008152	0.423	metabolic process
GO:0044237	0.411	cellular metabolic process
GO:0009410	0.406	response to xenobiotic stimulus
GO:0032502	0.367	developmental process
GO:0048856	0.357	anatomical structure development
GO:0031323	0.327	regulation of cellular metabolic process
GO:0065009	0.325	regulation of molecular function
GO:0080090	0.318	regulation of primary metabolic process
GO:0065008	0.317	regulation of biological quality
GO:0048583	0.316	regulation of response to stimulus
GO:0023051	0.308	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.983	protein-containing complex
GO:0005622	0.975	intracellular anatomical structure
GO:0005737	0.967	cytoplasm
GO:0043226	0.888	organelle
GO:0043235	0.880	receptor complex
GO:0043227	0.728	membrane-bounded organelle
GO:0043231	0.709	intracellular membrane-bounded organelle
GO:0031974	0.383	membrane-enclosed lumen
GO:0070013	0.306	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]